StarFunc result for job id A7E2Y1

User Input

>input (1983 residues)
MSGNKRGSRASCPHRGAECLLPWAALNLQGFQLLLLHPSATAMMDVSELGESARYLRQGY
QEMTKVHTIPWDGKKRVWVPDEQDAYVEAEVKSEATGGRVTVETKDQKVLMVREAELQPM
NPPRFDLLEDMAMMTHLNEASVLHNLRQRYARWMIYTYSGLFCVTINPYKWLPVYTASVV
AAYKGKRRSDSPPHIYAVADNAYNDMLRNRDNQSMLITGESGAGKTVNTKRVIQYFAIVA
ALGDGPGKKAQFLATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPS
GKLASADIDSYLLEKSRVIFQLPGERSYHVYYQILSGRKPELQDMLLLSMNPYDYHFCSQ
GVITVDNMNDGEELIATDHAMDILGFSVDEKCACYKIVGALLHFGNMKFKQKQREEQAEA
DGTESADKAAYLMGVSSGDLLKGLLHPRVRVGNEYVTKGQSVEQVVFAVGALAKATYDRL
FRWLVSRINQTLDTKLPRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNQHMFV
LEQEEYKREGIDWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDASFRAKLYDN
HAGKSPNFQQPRPDKKRKYQAHFEVVHYAGVVPYSIVGWLEKNKDPLNETVVPIFQKSQN
RLLATLYENYAGSCSTEPPKSGVKEKRKKAASFQTVSQLHKENLNKLMTNLRATQPHFVR
CIVPNENKTPGVMDAFLVLHQLRCNGVLEGIRICRQGFPNRLLYTDFRQRYRILNPSAIP
DDTFMDSRKATEKLLGSLDLDHTQYQFGHTKVFFKAGLLGVLEELRDQRLAKVLTLLQAR
SRGRLMRLEYQRLLGGRDALFTIQWNIRAFNAVKNWSWMKLFFKMKPLLRSAQAEEELAA
LRAELRGLRGALAAAEAKRQELEETHVSITQEKNDLALQLQAEQDNLADAEERCHLLIKS
KVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDIDDLELTLAKAEKEKQAT
ENKVKNLTEEMAALDESVARLTKEKKALQEAHQQALGDLQAEEDRVSALTKAKLRLEQQV
EDLECSLEQEKKLRMDTERAKRKLEGDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLS
LRVEDEQLLGAQMQKKIKELQARAEELEEELEAERAARARVEKQRAEAARELEELSERLE
EAGGASAGQREGCRKREAELGRLRRELEEAALRHEATVAALRRKQAEGAAELGEQVDSLQ
RVRQKLEKEKSELRMEVDDLAANVETLTRAKASAEKLCRTYEDQLSEAKIKVEELQRQLA
DASTQRGRLQTESGELSRLLEEKECLISQLSRGKALAAQSLEELRRQLEEESKAKSALAH
AVQALRHDCDLLREQHEEEAEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEELEEAKK
KLALRLQEAEEGVEAANAKCSSLEKAKLRLQTESEDVTLELERATSAAAALDKKQRHLER
ALEERRRQEEEMQRELEAAQRESRGLGTELFRLRHGHEEALEALETLKRENKNLQEEISD
LTDQVSLSGKSIQELEKTKKALEGEKSEIQAALEEAEGALELEETKTLRIQLELSQVKAE
VDRKLAEKDEECANLRRNHQRAVESLQASLDAETRARNEALRLKKKMEGDLNDLELQLGH
ATRQATEAQAATRLMQAQLKEEQAGRDEEQRLAAELHEQAQALERRASLLAAELEELRAA
LEQGERSRRLAEQELLEATERLNLLHSQNTGLLNQKKKLEADLAQLSGEVEEAAQERREA
EEKAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQ
VQKLEAKVRELEAELDAEQKKHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKL
QSKVKSYKRQFEEAEQQANTNLAKYRKAQHELDDAEERADMAETQANKLRARTRDALGPK
HKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JY53	0.640	0.661	0.000	1915	0.545	0.564	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	AFDB:A0A0N4STT5	0.726	0.717	0.000	2008	0.663	0.654	A0A0N4STT5.pdb.gz
3	AFDB:A7E2Y1	1.000	1.000	0.000	1983	1.000	1.000	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.628	0.642	0.000	1938	0.641	0.656	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B3DFS9	0.645	0.648	0.000	1974	0.389	0.391	B3DFS9.pdb.gz
6	AFDB:B8A568	0.683	0.698	0.000	1937	0.650	0.665	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
7	AFDB:B8JLS3	0.709	0.725	0.000	1936	0.660	0.676	B8JLS3.pdb.gz
8	AFDB:E7FD18	0.700	0.713	0.000	1945	0.722	0.736	E7FD18.pdb.gz
9	AFDB:F1QC64	0.612	0.690	0.000	1749	0.345	0.391	F1QC64.pdb.gz
10	AFDB:F1R3G4	0.620	0.617	0.000	1992	0.383	0.382	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	PDB:4pa0A	0.332	0.657	4.050E-98	974	0.267	0.543	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.332	0.697	2.528E-95	920	0.263	0.566	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.331	0.672	1.400E-90	952	0.260	0.541	4p7hB.pdb.gz
14	PDB:5tbyA	0.359	0.712	6.846E-88	954	0.334	0.695	5tbyA.pdb.gz
15	PDB:7mf3B	0.356	0.767	3.150E-66	896	0.220	0.488	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.334	0.654	8.817E-62	995	0.134	0.267	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.355	0.819	2.871E-53	817	0.110	0.268	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:7nkxZ	0.023	0.264	1.796E-1	156	0.007	0.090	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:2eyqA	0.036	0.055	2.526E-1	1146	0.014	0.024	2eyqA.pdb.gz
20	PDB:7m8eF	0.028	0.049	5.249E-1	967	0.009	0.019	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2139	1922	0.560	0.578	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	2633	1912	0.654	0.678	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	2642	1937	0.653	0.669	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	2655	1939	0.658	0.673	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	2652	1938	0.666	0.682	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	724	1948	0.215	0.219	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	3597	1941	0.942	0.962	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1242	1972	0.389	0.391	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	4006	1983	1.000	1.000	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	2578	1938	0.642	0.657	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	2659	1939	0.662	0.677	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	3791	1941	0.943	0.963	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	2577	1937	0.652	0.667	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	2651	1939	0.658	0.673	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	2648	1943	0.659	0.673	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	2681	1938	0.673	0.688	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1204	1992	0.386	0.385	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	3532	1929	0.919	0.945	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	2653	1942	0.660	0.674	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	2649	1942	0.658	0.671	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.2e+02	13.0	AAA domain
2	PF00038 Filament	2.3	19.3	Intermediate filament protein
3	PF00063 Myosin_head	1.4e-281	947.3	Myosin head (motor domain)
4	PF02736 Myosin_N	1.2e-10	52.2	Myosin N-terminal SH3-like domain
5	PF01576 Myosin_tail_1	6.2e-143	489.7	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.895	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000450385	0.868	Myosin light chain 6B
3	9606.ENSP00000357516	0.860	Tropomyosin alpha-3 chain
4	9606.ENSP00000217652	0.856	Myosin regulatory light chain 12A
5	9606.ENSP00000351022	0.851	Tropomyosin alpha-1 chain
6	9606.ENSP00000345230	0.849	Tropomyosin alpha-4 chain
7	9606.ENSP00000463559	0.848	Myosin regulatory light chain 12B
8	9606.ENSP00000379210	0.841	Myosin light chain 3
9	9606.ENSP00000279022	0.840	Myosin regulatory light polypeptide 9
10	9606.ENSP00000347055	0.837	Myosin light chain 4
11	9606.ENSP00000252699	0.833	Alpha-actinin-4
12	9606.ENSP00000223167	0.821	Myosin regulatory light chain 10
13	9606.ENSP00000383023	0.810	Myosin light chain 5
14	9606.ENSP00000223364	0.804	Myosin regulatory light chain 2, atrial isoform
15	9606.ENSP00000446955	0.803	Myosin light polypeptide 6
16	9606.ENSP00000325239	0.799	Myosin light chain, phosphorylatable, fast skeletal muscle
17	9606.ENSP00000228841	0.798	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
18	9606.ENSP00000274364	0.766	Ras GTPase-activating-like protein IQGAP2
19	9606.ENSP00000299198	0.764	Creatine kinase B-type
20	9606.ENSP00000379051	0.736	Transcriptional activator protein Pur-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003774	0.966	cytoskeletal motor activity
GO:0000146	0.921	microfilament motor activity
GO:0008092	0.867	cytoskeletal protein binding
GO:0005198	0.726	structural molecule activity
GO:0042802	0.537	identical protein binding
GO:0044877	0.498	protein-containing complex binding
GO:0003779	0.430	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0009987	0.971	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0044057	0.925	regulation of system process
GO:0090257	0.865	regulation of muscle system process
GO:0006937	0.854	regulation of muscle contraction
GO:0008016	0.833	regulation of heart contraction
GO:0032501	0.823	multicellular organismal process
GO:0006942	0.804	regulation of striated muscle contraction
GO:0032970	0.773	regulation of actin filament-based process
GO:0006874	0.771	intracellular calcium ion homeostasis
GO:0055117	0.744	regulation of cardiac muscle contraction
GO:0050848	0.673	regulation of calcium-mediated signaling
GO:1903115	0.621	regulation of actin filament-based movement
GO:0003008	0.576	system process
GO:0032502	0.574	developmental process
GO:0048856	0.528	anatomical structure development
GO:0051480	0.477	regulation of cytosolic calcium ion concentration
GO:0050896	0.442	response to stimulus
GO:0048518	0.348	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.997	contractile fiber
GO:0005829	0.900	cytosol
GO:0030016	0.752	myofibril
GO:0043227	0.745	membrane-bounded organelle
GO:0032991	0.624	protein-containing complex
GO:0005856	0.558	cytoskeleton
GO:0043231	0.544	intracellular membrane-bounded organelle
GO:0015629	0.518	actin cytoskeleton
GO:0030017	0.379	sarcomere
GO:0016459	0.350	myosin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.921	myosin ATPase.

[back to server]