StarFunc result for job id A7KAX9

User Input

>input (2087 residues)
METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNV
HPRERPDWEETLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAEC
AHFHYENVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLD
KHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWME
IDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTLEVGDIVSVIDMPPKVLSTWW
RGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLK
QRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLI
KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACF
SGTAAFMEVRIQSVVVEFILNHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTL
EEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLERKRPQNKMKKSPVGSW
RSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGTLRSAKSEESLTSLHAVDGDS
KLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIPALMSPHSAED
VDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLS
KSPSMSISEPISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMK
TNETVAQEAYESEVQPLDQVAAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQD
SVPVSSVSLIPPPPPPKNVARMLALALAESAQQASTQSLKRPGTSQAGYTNYGDIAVATT
EDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGE
QHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKNSMPTVSFLDQ
DQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPV
VGQVQAATNIGLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQP
GLPEKVRDGARVPLLHLRAESVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNY
HSFVTASSTSVDDALPLPLPVPQPKHASQKTVYSSFARPDVTTEPFGPDNCLHFNMTPNC
QYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAPGRNASGHHSKPCSRVEYVSS
LSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEPAYCPRPLYQY
KPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYT
SWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGK
TGLLSVAEGKESRHAAKAISPEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQS
SLRSRKLPDMGCSLPEHRAHQEASHRQFCESKNGPPYPQGAGQLDYGSKGIPDTSEPVSY
HNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPEKHSRDCYKEEEHLTQSIVPP
PKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVF
GGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7KAX9	0.999	0.999	0.000	2087	1.000	1.000	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
2	AFDB:F1MAK3	0.262	0.261	0.000	2101	0.880	0.874	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
3	AFDB:D4A9G6	0.140	0.191	8.155E-69	1310	0.236	0.376	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
4	AFDB:Q9VIS1	0.122	0.137	5.375E-55	1843	0.232	0.263	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
5	AFDB:A6X8Z5	0.106	0.154	1.945E-31	1425	0.191	0.279	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
6	AFDB:Q2M1Z3	0.104	0.146	5.589E-31	1444	0.187	0.270	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
7	AFDB:A0A0A0MRJ9	0.109	0.245	9.161E-30	890	0.133	0.312	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
8	AFDB:Q9VDS5	0.099	0.268	1.453E-16	740	0.052	0.146	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
9	AFDB:Q6REY9	0.097	0.166	2.595E-16	1182	0.097	0.171	Q6REY9.pdb.gz	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
10	PDB:1xa6A	0.094	0.468	4.556E-15	399	0.045	0.233	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
11	AFDB:Q9P2F6	0.099	0.168	8.905E-15	1191	0.089	0.156	Q9P2F6.pdb.gz	RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens OX=9606 GN=ARHGAP20 PE=1 SV=2
12	PDB:3cxlA	0.095	0.474	1.178E-14	402	0.044	0.229	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:6r3vA	0.090	0.902	9.402E-13	198	0.025	0.263	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
14	PDB:5jcpA	0.081	0.447	3.060E-11	361	0.023	0.130	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.080	0.423	5.468E-11	382	0.025	0.136	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:2dybA	0.046	0.224	2.055E-7	298	0.015	0.107	2dybA.pdb.gz
17	PDB:3qwyA	0.033	0.330	2.340E-3	170	0.006	0.076	3qwyA.pdb.gz
18	PDB:1griA	0.034	0.264	2.741E-3	211	0.011	0.114	1griA.pdb.gz
19	PDB:3ehqA	0.026	0.283	2.890E-3	182	0.009	0.104	3ehqA.pdb.gz
20	PDB:2lqnA	0.028	0.181	6.722E-3	303	0.018	0.125	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6H2	0.0	3573	2046	0.866	0.884	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
2	A0A8I6AJS5	0.0	701	1309	0.184	0.293	A0A8I6AJS5_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=3 SV=1
3	A0A8I6GFW8	0.0	3504	2070	0.862	0.869	A0A8I6GFW8_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
4	A0A8I6GIC6	0.0	3557	2061	0.866	0.877	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
5	A1A5D2	0.0	698	748	0.180	0.503	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
6	A7KAX9	0.0	4322	2087	1.000	1.000	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
7	D4A9G6	0.0	704	1354	0.188	0.290	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
8	F1MAK3	0.0	3605	2101	0.880	0.874	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
9	O14559	0.0	712	1287	0.189	0.306	RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens OX=9606 GN=ARHGAP33 PE=1 SV=2
10	Q80YF9	0.0	706	1305	0.184	0.295	RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus OX=10090 GN=Arhgap33 PE=1 SV=1
11	Q811P8	0.0	3650	2089	0.878	0.877	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2
12	Q9VIS1	7.60e-141	487	1843	0.128	0.145	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
13	A0A0A0MRJ9	2.75e-103	356	890	0.096	0.225	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
14	Q7Z6I6	1.51e-102	359	1101	0.096	0.182	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
15	A6X8Z5	1.50e-98	353	1425	0.092	0.135	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
16	Q2M1Z3	3.19e-97	349	1444	0.094	0.136	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
17	Q20498	7.17e-81	286	759	0.080	0.221	RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans OX=6239 GN=rrc-1 PE=1 SV=3
18	Q6TLK4	4.97e-35	148	869	0.037	0.089	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
19	Q6ZUM4	1.01e-33	144	889	0.036	0.084	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
20	Q8IWW6	3.18e-30	132	846	0.035	0.086	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00787 PX	97	15.1	PX domain
2	PF00620 RhoGAP	1.3e-40	150.1	RhoGAP domain
3	PF02755 RPEL	1.2e+02	13.8	RPEL repeat
4	PF00018 SH3_1	0.0015	29.4	SH3 domain
5	PF07653 SH3_2	0.0099	27.0	Variant SH3 domain
6	PF14604 SH3_9	5.3e-05	34.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310561

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.986	Transforming protein RhoA
2	9606.ENSP00000383118	0.985	Cell division control protein 42 homolog
3	9606.ENSP00000348461	0.979	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000344456	0.952	Catenin beta-1
5	9606.ENSP00000431418	0.949	High affinity nerve growth factor receptor
6	9606.ENSP00000358525	0.923	Beta-nerve growth factor
7	9606.ENSP00000300574	0.917	Adapter molecule crk
8	9606.ENSP00000379287	0.836	14-3-3 protein zeta/delta
9	9606.ENSP00000274376	0.777	Ras GTPase-activating protein 1
10	9606.ENSP00000306866	0.707	Gamma-aminobutyric acid receptor-associated protein
11	9606.ENSP00000382428	0.683	Disks large homolog 4
12	9606.ENSP00000376306	0.680	Citron Rho-interacting kinase
13	9606.ENSP00000269141	0.668	Cadherin-2
14	9606.ENSP00000260363	0.666	Kinesin-like protein KIF23
15	9606.ENSP00000360793	0.666	Kinesin-like protein KIF20B
16	9606.ENSP00000378356	0.666	Kinesin-like protein KIF20A
17	9606.ENSP00000260762	0.660	Exocyst complex component 6
18	9606.ENSP00000480987	0.651	DNA replication licensing factor MCM3
19	9606.ENSP00000477455	0.639	Glutamate receptor ionotropic, NMDA 2B
20	9606.ENSP00000262105	0.632	DNA replication licensing factor MCM4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0019899	0.481	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0016043	0.985	cellular component organization
GO:0048522	0.981	positive regulation of cellular process
GO:2001222	0.978	regulation of neuron migration
GO:0120035	0.966	regulation of plasma membrane bounded cell projection organization
GO:0048856	0.964	anatomical structure development
GO:0030335	0.963	positive regulation of cell migration
GO:0061387	0.962	regulation of extent of cell growth
GO:0050793	0.957	regulation of developmental process
GO:0022603	0.953	regulation of anatomical structure morphogenesis
GO:0032501	0.952	multicellular organismal process
GO:0031346	0.951	positive regulation of cell projection organization
GO:0010975	0.936	regulation of neuron projection development
GO:0030307	0.919	positive regulation of cell growth
GO:0007275	0.912	multicellular organism development
GO:0050772	0.901	positive regulation of axonogenesis
GO:2001224	0.885	positive regulation of neuron migration
GO:0048639	0.883	positive regulation of developmental growth
GO:0060322	0.881	head development
GO:0045773	0.870	positive regulation of axon extension
GO:0007399	0.860	nervous system development
GO:0021549	0.832	cerebellum development
GO:0051056	0.807	regulation of small GTPase mediated signal transduction
GO:0050896	0.507	response to stimulus
GO:0051716	0.442	cellular response to stimulus
GO:0007154	0.389	cell communication
GO:0007165	0.310	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043229	0.875	intracellular organelle
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0043232	0.497	intracellular non-membrane-bounded organelle
GO:0016020	0.404	membrane
GO:0005794	0.384	Golgi apparatus
GO:0001650	0.367	fibrillar center
GO:0005829	0.357	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]