StarFunc result for job id A7MBM2

User Input

>input (1401 residues)
MDGDSSSSSGGSGPAPGPGPEGEQRPEGEPLAPDGGSPDSTQTKAVPPEASPERSCSLHS
CPLEDPSSSSGPPPTTSTLQPVGPSSPLAPAHFTYPRALQEYQGGSSLPGLGDRAALCSH
GSSLSPSPAPSQRDGTWKPPAVQHHVVSVRQERAFQMPKSYSQLIAEWPVAVLMLCLAVI
FLCTLAGLLGARLPDFSKPLLGFEPRDTDIGSKLVVWRALQALTGPRKLLFLSPDLELNS
SSSHNTLRPAPRGSAQESAVRPRRMVEPLEDRRQENFFCGPPEKSYAKLVFMSTSSGSLW
NLHAIHSMCRMEQDQIRSHTSFGALCQRTAANQCCPSWSLGNYLAVLSNRSSCLDTTQAD
AARTLALLRTCALYYHSGALVPSCLGPGQNKSPRCAQVPTKCSQSSAIYQLLHFLLDRDF
LSPQTTDYQVPSLKYSLLFLPTPKGASLMDIYLDRLATPWGLADNYTSVTGMDLGLKQEL
LRHFLVQDTVYPLLALVAIFFGMALYLRSLFLTLMVLLGVLGSLLVAFFLYQVAFRMAYF
PFVNLAALLLLSSVCANHTLIFFDLWRLSKSQLPSGGLAQRVGRTMHHFGYLLLVSGLTT
SAAFYASYLSRLPAVRCLALFMGTAVLVHLALTLVWLPASAVLHERYLARGCARRARGRW
EGSAPRRLLLALHRRLRGLRRAAAGTSRLLFQRLLPCGVIKFRYIWICWFAALAAGGAYI
AGVSPRLRLPTLPPPGGQVFRPSHPFERFDAEYRQLFLFEQLPQGEGGHMPVVLVWGVLP
VDTGDPLDPRSNSSLVRDPAFSASGPEAQRWLLALCHRARNQSFFDTLQEGWPTLCFVET
LQRWMESPSCARLGPDLCCGHSDFPWAPQFFLHCLKMMALEQGPDGTQDLGLRFDAHGSL
AALVLQFQTNFRNSPDYNQTQLFYNEVSHWLAAELGMAPPGLRRGWFTSRLELYSLQHSL
STEPAVVLGLALALAFATLLLGTWNVPLSLFSVAAVAGTVLLTVGLLVLLEWQLNTAEAL
FLSASVGLSVDFTVNYCISYHLCPHPDRLSRVAFSLRQTSCATAVGAAALFAAGVLMLPA
TVLLYRKLGIILMMVKCVSCGFASFFFQSLCCFFGPEKNCGQILWPCAHLPWDAGTGDPG
GEKAGRPRPGSVGGMPGSCSEQYELQPLARRRSPSFDTSTATSKLSHRPSVLSEDLQLHD
GPCCSRPPPAPASPRELLLDHQAVFSQCPALQTSSPYKQAGPSPKTRARQDSQGEEAEPL
PASPEAPAHSPKAKAADPPDGFCSSASTLEGLSVSDETCLSTSEPSARVPDSVGVSPDDL
DDTGQPVLERGQLNGKRDTLWLALRETVYDPSLPASHHSSLSWKGRGGPGDGSPVVLPNS
QPDLPDVWLRRPSTHTSGYSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7MBM2	1.000	1.000	0.000	1401	1.000	1.000	A7MBM2.pdb.gz	DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2
2	AFDB:Q6R5J1	0.666	0.633	4.262E-99	1476	0.450	0.428	Q6R5J1.pdb.gz	DISP2_DANRE Protein dispatched homolog 2 OS=Danio rerio OX=7955 GN=disp2 PE=2 SV=1
3	AFDB:Q3TDN0	0.653	0.603	1.849E-89	1521	0.370	0.341	Q3TDN0.pdb.gz	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
4	AFDB:Q96F81	0.645	0.595	9.388E-89	1524	0.360	0.331	Q96F81.pdb.gz	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
5	PDB:7e2iD	0.594	0.899	3.023E-59	907	0.291	0.449	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
6	PDB:6tbuA	0.553	0.902	1.891E-52	842	0.193	0.322	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
7	AFDB:Q9XWL9	0.393	0.576	1.511E-19	895	0.084	0.132	Q9XWL9.pdb.gz	PTR18_CAEEL Patched-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=ptr-18 PE=1 SV=3
8	PDB:6v3fA	0.405	0.452	9.597E-18	1234	0.112	0.127	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
9	PDB:6dmyA	0.403	0.541	2.111E-14	992	0.108	0.153	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
10	PDB:7n6bA	0.377	0.650	6.149E-14	757	0.074	0.137	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
11	PDB:7wnxA	0.347	0.611	4.817E-12	734	0.074	0.142	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
12	PDB:4zivB	0.266	0.344	6.580E-10	1046	0.079	0.105	4zivB.pdb.gz
13	PDB:2v50D	0.264	0.359	1.421E-9	998	0.062	0.087	2v50D.pdb.gz
14	PDB:3w9iF	0.266	0.353	4.507E-9	1033	0.065	0.088	3w9iF.pdb.gz
15	PDB:3nogA	0.256	0.343	5.123E-9	1012	0.067	0.093	3nogA.pdb.gz
16	AFDB:Q9P0X4	0.060	0.046	1.982E-3	2223	0.129	0.081	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
17	AFDB:F4HS99	0.040	0.034	2.690E-2	1797	0.058	0.045	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
18	AFDB:F4IAT2	0.057	0.049	6.327E-2	1823	0.106	0.081	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
19	AFDB:A0A096MKF8	0.047	0.037	6.603E-2	2190	0.151	0.097	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
20	AFDB:Q96UP3	0.052	0.052	1.202E-1	1400	0.117	0.117	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7MBM2	0.0	2821	1401	1.000	1.000	DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2
2	Q3TDN0	0.0	921	1521	0.324	0.298	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
3	Q6R5J1	0.0	1090	1476	0.439	0.417	DISP2_DANRE Protein dispatched homolog 2 OS=Danio rerio OX=7955 GN=disp2 PE=2 SV=1
4	Q6R5J2	0.0	907	1464	0.315	0.302	DISP1_DANRE Protein dispatched homolog 1 OS=Danio rerio OX=7955 GN=disp1 PE=2 SV=1
5	Q8CIP5	0.0	1996	1345	0.732	0.763	DISP2_MOUSE Protein dispatched homolog 2 OS=Mus musculus OX=10090 GN=Disp2 PE=1 SV=1
6	Q96F81	0.0	914	1524	0.316	0.291	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
7	Q9VNJ5	4.31e-128	429	1218	0.206	0.237	DISP_DROME Protein dispatched OS=Drosophila melanogaster OX=7227 GN=disp PE=1 SV=1
8	G5EEW0	2.71e-28	126	917	0.148	0.227	G5EEW0_CAEEL CHE-14 protein OS=Caenorhabditis elegans OX=6239 GN=che-14 PE=1 SV=1
9	Q9P2K9	1.40e-08	62.4	1392	0.031	0.032	DISP3_HUMAN Protein dispatched homolog 3 OS=Homo sapiens OX=9606 GN=DISP3 PE=2 SV=2
10	B9U3F2	1.69e-07	58.5	1338	0.029	0.030	DISP3_CHICK Protein dispatched homolog 3 OS=Gallus gallus OX=9031 GN=DISP3 PE=1 SV=1
11	X2J9B0	2.76e-06	54.7	1283	0.039	0.043	X2J9B0_DROME Niemann-Pick type C-1a, isoform E OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=1
12	Q7YU59	2.79e-06	54.7	1287	0.039	0.043	Q7YU59_DROME RE56428p OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
13	Q9VL24	2.98e-06	54.7	1287	0.039	0.043	Q9VL24_DROME Niemann-Pick type C-1a, isoform A OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=2
14	Q9U5W1	3.03e-06	54.7	1287	0.039	0.043	Q9U5W1_DROME NPC1 protein OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
15	Q6T3U3	2.01e-04	48.5	1331	0.099	0.104	NPCL1_RAT NPC1-like intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1l1 PE=1 SV=1
16	A0A2R8Q2J0	3.58e-04	47.8	1277	0.024	0.027	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
17	F1QNG7	3.58e-04	47.8	1276	0.024	0.027	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
18	A0A0R4IZV0	3.67e-04	47.8	1271	0.024	0.027	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
19	A0MJA4	0.002	45.4	1325	0.036	0.038	A0MJA4_CANLF Niemann-Pick C1-like 1 protein OS=Canis lupus familiaris OX=9615 GN=NPC1L1 PE=2 SV=1
20	B4DIP7	0.006	43.5	776	0.029	0.052	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03176 MMPL	1.8	19.0	MMPL family
2	PF12349 Sterol-sensing	1.1	20.6	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.913	Sonic hedgehog protein
2	9606.ENSP00000429969	0.903	Signal peptide, CUB domain and EGF like domain containing 2
3	9606.ENSP00000266991	0.890	Desert hedgehog protein
4	9606.ENSP00000295731	0.881	Indian hedgehog protein
5	9606.ENSP00000365756	0.780	Uncharacterized protein KIAA2013
6	9606.ENSP00000296543	0.706	N-alpha-acetyltransferase 15, NatA auxiliary subunit
7	9606.ENSP00000362136	0.641	Glycoprotein endo-alpha-1,2-mannosidase-like protein
8	9606.ENSP00000362071	0.635	Junctophilin-2
9	9606.ENSP00000446479	0.617	Adenosine monophosphate-protein transferase FICD
10	9606.ENSP00000317404	0.522	Carbohydrate sulfotransferase 13
11	9606.ENSP00000351697	0.521	DNA polymerase zeta catalytic subunit
12	9606.ENSP00000395340	0.507	Protein FAM185A
13	9606.ENSP00000463051	0.503	Growth/differentiation factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.872	transporter activity
GO:1904680	0.471	peptide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050789	0.988	regulation of biological process
GO:0050794	0.958	regulation of cellular process
GO:0009987	0.766	cellular process
GO:0032501	0.587	multicellular organismal process
GO:0048856	0.432	anatomical structure development
GO:0050896	0.425	response to stimulus
GO:0008152	0.363	metabolic process
GO:0019222	0.360	regulation of metabolic process
GO:0071704	0.337	organic substance metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0051716	0.326	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.388	intracellular anatomical structure
GO:0043231	0.378	intracellular membrane-bounded organelle
GO:0005737	0.352	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]