StarFunc result for job id A8CG34

User Input

>input (1229 residues)
MSPAAAAAGAGERRRPIASVRDGRGRGCGGPAGAALLGLSLVGLLLYLVPAAAALAWLAV
GTTAAWWGLSREPRGSRPLSSFVQKARHRRTLFASPPAKSTANGNLLEPRTLLEGPDPAE
LLLMGSYLGKPGPPQPAPAPEGQDLRNRPGRRPPARPAPRSTPPSQPTHRVHHFYPSLPT
PLLRPSGRPSPRDRGTLPDRFVITPRRRYPIHQTQYSCPGVLPTVCWNGYHKKAVLSPRN
SRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKR
TVEEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVASGVPASFVPKPGSLKRGLNSQSSDD
HLNKRSRSSSMSSLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASS
RSQTPERPAKKIREEELCHHSSSSTPLAADKESQGEKAADTTPRKKQNSNSQSTPGSSGQ
RKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVT
ETPPTTQPSFTFTLPAAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTE
ALSPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQ
AETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGL
TPPGPSVSATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTT
TAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFL
FGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSAADFSGFGS
TLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAA
KPALTPSFGSSFTFGNSAAPAPATAPTPAPASTIKIVPAHVPTPIQPTFGGATHSAFGLK
ATASAFGAPASSQPAFGGSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFG
GSAAPAGSGSFGINVATPGSSATTGAFSFGAGQSGSTATSTPFTGGLGQNALGTTGQSTP
FAFNVGSTTESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSAPAQGFVGVGPFGSA
APSFSIGAGSKTPGARQRLQARRQHTRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52591	0.197	0.201	0.000	1199	0.689	0.706	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
2	AFDB:Q96HA1	0.110	0.109	0.000	1249	0.963	0.948	Q96HA1.pdb.gz	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
3	AFDB:P91457	0.034	0.034	8.642E-8	1217	0.200	0.202	P91457.pdb.gz	P91457_CAEEL RanBP2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-7 PE=1 SV=1
4	AFDB:E9Q4F7	0.035	0.021	1.100E-7	2643	0.185	0.086	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
5	AFDB:Q09904	0.039	0.041	2.096E-7	1159	0.199	0.211	Q09904.pdb.gz	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
6	AFDB:P49790	0.038	0.033	2.894E-7	1475	0.204	0.170	P49790.pdb.gz	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
7	AFDB:Q9VXE6	0.040	0.033	5.086E-7	1883	0.223	0.146	Q9VXE6.pdb.gz	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
8	AFDB:Q9NZP6	0.035	0.037	2.351E-6	1156	0.221	0.235	Q9NZP6.pdb.gz	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
9	AFDB:Q9Z1Q1	0.042	0.032	2.548E-6	1818	0.172	0.117	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
10	AFDB:O13736	0.030	0.027	3.517E-6	1420	0.138	0.119	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8CG34	0.0	2363	1229	1.000	1.000	P121C_HUMAN Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3
2	P52591	0.0	1078	1199	0.639	0.655	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
3	Q96HA1	0.0	1840	1249	0.962	0.946	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
4	C9J370	1.98e-42	157	250	0.061	0.300	C9J370_HUMAN POM121 and ZP3 fusion (Fragment) OS=Homo sapiens OX=9606 GN=POMZP3 PE=4 SV=1
5	Q6PJE2	8.25e-37	139	187	0.060	0.396	POZP3_HUMAN POM121 and ZP3 fusion protein OS=Homo sapiens OX=9606 GN=POMZP3 PE=2 SV=4
6	Q3SYA9	1.25e-28	122	428	0.100	0.287	P12L1_HUMAN Putative POM121-like protein 1 OS=Homo sapiens OX=9606 GN=POM121L1P PE=5 SV=2
7	Q9NZP6	2.02e-12	74.3	1156	0.138	0.146	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
8	M9PCJ6	1.49e-05	52.4	18641	0.090	0.006	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PC48	1.56e-05	52.4	18095	0.090	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	Q8RY25	0.001	45.8	1041	0.089	0.105	NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana OX=3702 GN=NUP98A PE=1 SV=1
11	Q99PB3	0.004	44.3	1987	0.094	0.058	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
12	Q6DIC6	0.026	41.6	2087	0.087	0.051	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
13	F4ID16	0.21	38.5	997	0.065	0.080	NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana OX=3702 GN=NUP98B PE=1 SV=1
14	Q80TJ5	0.24	38.1	1736	0.086	0.061	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
15	Q12816	1.2	35.8	1431	0.102	0.087	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
16	A0A0R4IAQ8	1.3	35.8	1807	0.039	0.027	A0A0R4IAQ8_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=2
17	E7F981	1.4	35.8	1814	0.039	0.026	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
18	Q640Z6	3.7	34.3	1605	0.020	0.015	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
19	Q09904	4.9	33.9	1159	0.045	0.047	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
20	Q584I6	5.1	33.9	641	0.060	0.115	Q584I6_TRYB2 Nucleoporin (NUP54/57), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.740 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15229 POM121	2.6e-97	336.7	POM121 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033018

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000042467	0.843	Uncharacterized protein
2	9598.ENSPTRP00000021737	0.834	Nucleoporin NUP53
3	9598.ENSPTRP00000051405	0.830	Uncharacterized protein
4	9598.ENSPTRP00000013898	0.827	Nuclear pore complex protein Nup93
5	9598.ENSPTRP00000036762	0.815	Nucleoporin 214kDa
6	9598.ENSPTRP00000009111	0.810	Nucleoporin 37kDa
7	9598.ENSPTRP00000008831	0.803	Functions as a component of the nuclear pore complex (NPC).
8	9598.ENSPTRP00000030438	0.800	Uncharacterized protein
9	9598.ENSPTRP00000048096	0.793	Nucleoporin 160kDa
10	9598.ENSPTRP00000028814	0.786	Uncharacterized protein
11	9598.ENSPTRP00000025259	0.774	Uncharacterized protein
12	9598.ENSPTRP00000033799	0.772	Nucleoporin 205kDa
13	9598.ENSPTRP00000014727	0.756	Nucleoporin 88kDa
14	9598.ENSPTRP00000036669	0.755	Nucleoporin 188kDa
15	9598.ENSPTRP00000041699	0.730	Uncharacterized protein
16	9598.ENSPTRP00000001306	0.724	NDC1 transmembrane nucleoporin
17	9598.ENSPTRP00000044045	0.719	Ran GTPase activating protein 1
18	9598.ENSPTRP00000003533	0.716	Nucleoporin 133kDa
19	9598.ENSPTRP00000016821	0.706	SEH1-like
20	9598.ENSPTRP00000044722	0.704	GLE1 RNA export mediator homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017056	0.635	structural constituent of nuclear pore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0043933	0.980	protein-containing complex organization
GO:0006996	0.972	organelle organization
GO:0006997	0.912	nucleus organization
GO:0006999	0.843	nuclear pore organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	0.999	nuclear envelope
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0031090	0.987	organelle membrane
GO:0031965	0.975	nuclear membrane
GO:0032991	0.868	protein-containing complex
GO:0005643	0.704	nuclear pore
GO:0005829	0.527	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]