StarFunc result for job id A8K0R7

User Input

>input (811 residues)
MLLPTTIQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLCQPPAQG
FVQRPLPALQVVPAKRVPAPKAPDEQGSMLTPLSASDPLAVTSLSSSSAHPFISNLHTRH
TEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRE
RHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKASGSTL
RGCTEERTLSLTSLGLSMPADPCEGGARSCLVTESARGGLQNGQSVDVEETLPSEPENGA
LLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQ
CDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYL
SSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKR
EREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRS
EESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLT
QAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVC
DFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGC
LRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDG
LILSPPGTIVSQEEDIVTVTDAEGRACGWAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN08	0.051	0.053	2.222E-2	757	0.137	0.147	Q7TN08.pdb.gz	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
2	AFDB:Q8R4I1	0.053	0.051	2.362E-2	867	0.133	0.125	Q8R4I1.pdb.gz	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
3	AFDB:P31264	0.045	0.046	3.620E-2	782	0.150	0.156	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
4	AFDB:P41885	0.057	0.048	9.611E-2	1106	0.137	0.100	P41885.pdb.gz	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
5	AFDB:Q9P7T4	0.055	0.049	9.611E-2	1019	0.113	0.090	Q9P7T4.pdb.gz	MRC1_SCHPO Mediator of replication checkpoint protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrc1 PE=1 SV=1
6	AFDB:E7F640	0.042	0.039	1.769E-1	866	0.144	0.135	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
7	AFDB:Q9EQZ7	0.052	0.033	1.769E-1	1530	0.125	0.066	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
8	AFDB:D4A9T1	0.043	0.037	2.125E-1	987	0.158	0.130	D4A9T1.pdb.gz	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
9	AFDB:Q9VTS9	0.041	0.026	2.258E-1	1900	0.133	0.057	Q9VTS9.pdb.gz	Q9VTS9_DROME Rolling pebbles, isoform B OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=2
10	AFDB:Q9W1R4	0.057	0.038	2.883E-1	1395	0.153	0.089	Q9W1R4.pdb.gz	ICE1_DROME Little elongation complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Ice1 PE=1 SV=2
11	PDB:4hrgA	0.060	0.267	1.048	114	0.023	0.167	4hrgA.pdb.gz	SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
12	PDB:1gafL	0.044	0.145	2.463	214	0.011	0.042	1gafL.pdb.gz	The immunological evolution of catalysis.
13	PDB:1knoE	0.044	0.146	2.958	214	0.009	0.033	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
14	PDB:3w1zB	0.030	0.111	3.144	143	0.010	0.056	3w1zB.pdb.gz
15	PDB:1u02A	0.049	0.152	3.552	229	0.007	0.026	1u02A.pdb.gz	Crystal structure of trehalose-6-phosphate phosphatase-related protein: biochemical and biological implications.
16	PDB:4yrvA	0.042	0.088	3.775	288	0.028	0.080	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
17	PDB:3tgoD	0.043	0.131	4.013	186	0.022	0.097	3tgoD.pdb.gz
18	PDB:1ek8A	0.046	0.177	4.265	185	0.006	0.027	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
19	PDB:7oa6B	0.042	0.156	5.122	152	0.016	0.086	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
20	PDB:4bvuA	0.053	0.193	5.445	171	0.015	0.070	4bvuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	R9R4D9	1.2	34.7	268	0.022	0.067	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
2	Q9R0M0	1.4	35.0	2919	0.051	0.014	CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus OX=10090 GN=Celsr2 PE=1 SV=3
3	Q38DX2	2.5	34.3	2246	0.039	0.014	Q38DX2_TRYB2 DNA polymerase epsilon catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1820 PE=3 SV=1
4	O61362	2.8	33.9	756	0.028	0.030	O61362_DROME CROL GAMMA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
5	M9PCY3	2.9	33.9	878	0.028	0.026	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
6	Q8MRK4	2.9	33.9	878	0.028	0.026	Q8MRK4_DROME Crooked legs, isoform D OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
7	M9PD94	3.0	33.9	907	0.028	0.025	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
8	Q96EG3	3.3	33.5	531	0.022	0.034	ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens OX=9606 GN=ZNF837 PE=1 SV=2
9	M9PFM9	3.7	33.5	686	0.028	0.034	M9PFM9_DROME Crooked legs, isoform H OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
10	O61360	4.3	33.5	962	0.028	0.024	O61360_DROME CROL ALPHA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
11	Q9UL36	4.5	33.5	1845	0.016	0.007	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
12	J9VT45	4.6	33.1	738	0.021	0.023	J9VT45_CRYNH C2H2-type domain-containing protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_03366 PE=4 SV=2
13	Q9VZS5	4.6	32.0	144	0.039	0.222	RL28_DROME Large ribosomal subunit protein eL28 OS=Drosophila melanogaster OX=7227 GN=RpL28 PE=1 SV=1
14	E9Q8T2	4.9	33.1	1174	0.021	0.014	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
15	O61361	5.1	33.1	891	0.028	0.026	O61361_DROME CROL BETA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
16	Q07231	5.7	32.7	555	0.012	0.018	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
17	M9NES1	6.4	32.7	1373	0.012	0.007	M9NES1_DROME Zelda, isoform D OS=Drosophila melanogaster OX=7227 GN=zld PE=4 SV=1
18	Q3ZBY5	6.4	32.7	466	0.012	0.021	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
19	X2BZL0	6.5	32.7	1367	0.012	0.007	X2BZL0_DROME Zelda, isoform F OS=Drosophila melanogaster OX=7227 GN=zld PE=4 SV=1
20	Q7Z4V0	6.6	32.7	828	0.016	0.016	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15961 DUF4764	0	1253.0	Domain of unknown function (DUF4764)
2	PF00096 zf-C2H2	6.1e+02	12.3	Zinc finger, C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008591143.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008591144.1	0.529	Zinc finger protein 839-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009889	0.974	regulation of biosynthetic process
GO:0019219	0.961	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0031326	0.952	regulation of cellular biosynthetic process
GO:0010468	0.947	regulation of gene expression
GO:0009987	0.837	cellular process
GO:0051252	0.772	regulation of RNA metabolic process
GO:0010556	0.727	regulation of macromolecule biosynthetic process
GO:2001141	0.529	regulation of RNA biosynthetic process
GO:0006355	0.491	regulation of DNA-templated transcription
GO:0032501	0.468	multicellular organismal process
GO:0048518	0.344	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.986	nucleoplasm
GO:0005737	0.748	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]