StarFunc result for job id A8K2U0

User Input

>input (1454 residues)
MWAQLLLGMLALSPAIAEELPNYLVTLPARLNFPSVQKVCLDLSPGYSDVKFTVTLETKD
KTQKLLEYSGLKKRHLHCISFLVPPPAGGTEEVATIRVSGVGNNISFEEKKKVLIQRQGN
GTFVQTDKPLYTPGQQVYFRIVTMDSNFVPVNDKYSMVELQDPNSNRIAQWLEVVPEQGI
VDLSFQLAPEAMLGTYTVAVAEGKTFGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKI
CCRYTYGKPMLGAVQVSVCQKANTYWYREVEREQLPDKCRNLSGQTDKTGCFSAPVDMAT
FDLIGYAYSHQINIVATVVEEGTGVEANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGK
IRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQ
MEDLVYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPAD
ASPDQEISFSYYLIGKGSLVMEGQKHLNSKKKGLKASFSLSLTFTSRLAPDPSLVIYAIF
PSGGVVADKIQFSVEMCFDNQVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLL
LRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPMPQGHSSQRSII
WRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDCSHRSPEYSTAMGAGGGHPEAFESSTP
LHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSP
TVGLTAFKPFFVDLTLPYSVVRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADS
QTSSCLCADDAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKP
VLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNL
DGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSN
GSYSAFGERDGNGNTWLTAFVTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVG
NLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDPMVSQGLRCLKNSATSTTNLYTQALL
AYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYA
LLAQLTKPSLTQKEIAKATSIVAWLAKQHNAYGGFSSTQDTVVALQALAKYATTAYMPSE
EINLVVKSTENFQRTFNIQSVNRLVFQQDTLPNVPGMYTLEASGQGCVYVQTVLRYNILP
PTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEG
TNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYL
PDEQATIQYSDPCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q1yA	0.894	0.944	0.000	1374	0.944	0.999	7q1yA.pdb.gz
2	PDB:7q5zA	0.857	0.924	0.000	1344	0.924	0.999	7q5zA.pdb.gz
3	PDB:7vonA	0.852	0.883	0.000	1399	0.393	0.408	7vonA.pdb.gz
4	AFDB:A0A0R4IDD1	0.865	0.872	0.000	1442	0.373	0.377	A0A0R4IDD1.pdb.gz
5	AFDB:A8K2U0	1.000	1.000	0.000	1454	1.000	1.000	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
6	AFDB:P01023	0.926	0.914	0.000	1474	0.404	0.398	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
7	AFDB:P20742	0.914	0.898	0.000	1482	0.385	0.378	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
8	AFDB:P28665	0.880	0.868	0.000	1476	0.371	0.366	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
9	AFDB:Q03626	0.901	0.882	0.000	1487	0.382	0.374	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
10	AFDB:Q61838	0.905	0.881	0.000	1495	0.387	0.377	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
11	AFDB:Q63041	0.895	0.869	0.000	1500	0.382	0.370	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
12	AFDB:Q6GQT1	0.922	0.910	0.000	1474	0.392	0.387	Q6GQT1.pdb.gz	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
13	AFDB:Q7SIH1	0.911	0.878	0.000	1510	0.397	0.382	Q7SIH1.pdb.gz	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
14	PDB:4lnvA	0.617	0.693	2.618E-78	1276	0.222	0.253	4lnvA.pdb.gz
15	PDB:7nycA	0.417	0.397	1.114E-65	1542	0.208	0.196	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4lnvB	0.571	0.761	6.826E-60	1063	0.193	0.264	4lnvB.pdb.gz
17	PDB:6h03A	0.412	0.481	5.213E-56	1223	0.182	0.216	6h03A.pdb.gz
18	PDB:5a42A	0.482	0.445	6.094E-52	1597	0.131	0.120	5a42A.pdb.gz
19	PDB:4ziqA	0.338	0.338	9.231E-49	1450	0.141	0.141	4ziqA.pdb.gz
20	PDB:4rtdA	0.348	0.430	1.444E-42	1122	0.125	0.162	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K2U0	0.0	3018	1454	1.000	1.000	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
2	B8QSI4	0.0	940	1442	0.387	0.390	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1
3	P01023	0.0	1068	1474	0.408	0.402	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
4	P06238	0.0	1039	1472	0.398	0.393	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
5	P20742	0.0	1000	1482	0.381	0.374	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
6	P28665	0.0	978	1476	0.384	0.379	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
7	Q03626	0.0	994	1487	0.393	0.384	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
8	Q61838	0.0	963	1495	0.389	0.378	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
9	Q63041	0.0	963	1500	0.381	0.369	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
10	Q6GQT1	0.0	1021	1474	0.393	0.387	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
11	Q7SIH1	0.0	1021	1510	0.400	0.385	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
12	Q6YHK3	1.10e-159	522	1445	0.289	0.291	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
13	Q8R422	5.65e-154	506	1442	0.287	0.290	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
14	Q9NFV7	1.42e-127	433	1420	0.289	0.296	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
15	Q9NFV8	7.38e-97	343	1354	0.251	0.270	Q9NFV8_DROME TEP1 protein OS=Drosophila melanogaster OX=7227 GN=Tep1 PE=2 SV=1
16	Q9VLY7	3.75e-94	337	1469	0.232	0.229	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
17	F1SBS4	8.26e-88	318	1642	0.270	0.239	F1SBS4_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=4
18	M9PD73	9.68e-85	308	1476	0.192	0.189	M9PD73_DROME Thioester-containing protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
19	Q9VIT9	1.14e-84	308	1496	0.193	0.187	Q9VIT9_DROME Thioester-containing protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=2
20	M9PDF6	2.20e-84	307	1478	0.193	0.190	M9PDF6_DROME Thioester-containing protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.2e-26	103.6	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.5e-22	91.9	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	2.9e-22	90.5	A-macroglobulin receptor binding domain
4	PF01835 MG2	6.2e-15	66.7	MG2 domain
5	PF17791 MG3	1e-16	72.3	Macroglobulin domain MG3
6	PF17789 MG4	1.3e-18	78.3	Macroglobulin domain MG4
7	PF05326 SVA	0.00012	33.4	Seminal vesicle autoantigen (SVA)
8	PF07678 TED_complement	2.5e-108	373.4	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340510	0.815	Periplakin
2	9606.ENSP00000301607	0.802	Envoplakin
3	9606.ENSP00000375683	0.792	Kallikrein-7
4	9606.ENSP00000366047	0.756	Kallikrein-6
5	9606.ENSP00000323856	0.749	Plectin
6	9606.ENSP00000243077	0.705	Prolow-density lipoprotein receptor-related protein 1
7	9606.ENSP00000358464	0.702	Leucine-rich repeat protein SHOC-2
8	9606.ENSP00000257189	0.699	Desmoglein-3
9	9606.ENSP00000369129	0.692	Desmoplakin
10	9606.ENSP00000286364	0.687	Ras GTPase-activating protein 2
11	9606.ENSP00000484472	0.683	Epiplakin
12	9606.ENSP00000215739	0.681	Leucine-zipper-like transcriptional regulator 1
13	9606.ENSP00000216373	0.639	Son of sevenless homolog 2
14	9606.ENSP00000479708	0.613	Protein MAL2
15	9606.ENSP00000387784	0.598	Son of sevenless homolog 1
16	9606.ENSP00000257192	0.575	Desmoglein-1
17	9606.ENSP00000307959	0.574	Dystonin
18	9606.ENSP00000246792	0.567	Ras-related protein R-Ras
19	9606.ENSP00000257198	0.550	Desmocollin-1
20	9606.ENSP00000364635	0.510	Protein-arginine deiminase type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030414	1.000	peptidase inhibitor activity
GO:0005515	0.990	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.983	regulation of biological process
GO:0009987	0.821	cellular process
GO:0019222	0.802	regulation of metabolic process
GO:0060255	0.785	regulation of macromolecule metabolic process
GO:0080090	0.768	regulation of primary metabolic process
GO:0051171	0.768	regulation of nitrogen compound metabolic process
GO:0050790	0.692	regulation of catalytic activity
GO:0051246	0.633	regulation of protein metabolic process
GO:0051336	0.555	regulation of hydrolase activity
GO:0050896	0.525	response to stimulus
GO:0030162	0.487	regulation of proteolysis
GO:0050794	0.453	regulation of cellular process
GO:0032502	0.424	developmental process
GO:0048856	0.389	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.997	extracellular exosome
GO:0071944	0.985	cell periphery
GO:0005886	0.930	plasma membrane
GO:0005622	0.906	intracellular anatomical structure
GO:0043229	0.897	intracellular organelle
GO:0005737	0.777	cytoplasm
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0012505	0.414	endomembrane system
GO:0005829	0.378	cytosol
GO:0031410	0.369	cytoplasmic vesicle
GO:0043233	0.332	organelle lumen
GO:0070013	0.320	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]