StarFunc result for job id A8K4G0

User Input

>input (201 residues)
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKI
LIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVI
VDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPE
EPGEQPIYMNFSEPLTKDMAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K4G0	1.000	1.000	1.222E-37	201	1.000	1.000	A8K4G0.pdb.gz	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
2	AFDB:Q3U497	0.750	0.723	3.843E-24	209	0.537	0.517	Q3U497.pdb.gz	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
3	AFDB:Q8TDQ1	0.629	0.452	3.656E-22	290	0.483	0.334	Q8TDQ1.pdb.gz	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
4	AFDB:Q6UXZ3	0.572	0.591	1.377E-21	194	0.443	0.459	Q6UXZ3.pdb.gz	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
5	AFDB:Q6SJQ5	0.573	0.474	2.751E-21	245	0.463	0.380	Q6SJQ5.pdb.gz	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
6	AFDB:Q8VCH2	0.548	0.499	2.201E-19	221	0.448	0.407	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
7	AFDB:Q496F6	0.601	0.591	9.857E-19	205	0.383	0.376	Q496F6.pdb.gz	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
8	AFDB:Q6SJQ7	0.549	0.333	1.251E-16	337	0.373	0.223	Q6SJQ7.pdb.gz	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
9	AFDB:Q7TSN2	0.572	0.509	1.251E-16	228	0.299	0.263	Q7TSN2.pdb.gz	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
10	AFDB:A0A0K2S4Q6	0.571	0.571	1.325E-16	201	0.363	0.363	A0A0K2S4Q6.pdb.gz	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
11	PDB:5ir3A	0.449	0.775	9.973E-8	111	0.109	0.198	5ir3A.pdb.gz
12	PDB:1cd0A	0.445	0.768	1.119E-7	111	0.095	0.171	1cd0A.pdb.gz
13	PDB:3zhlA	0.417	0.658	1.582E-7	121	0.124	0.207	3zhlA.pdb.gz
14	PDB:6xdsA	0.424	0.188	2.509E-7	485	0.134	0.056	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
15	PDB:3c2aL	0.451	0.423	2.658E-7	216	0.124	0.116	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
16	PDB:2cd0A	0.436	0.747	3.160E-7	111	0.109	0.198	2cd0A.pdb.gz
17	PDB:4y5xB	0.427	0.742	3.546E-7	111	0.104	0.189	4y5xB.pdb.gz
18	PDB:6sm1A	0.406	0.694	4.216E-7	111	0.129	0.234	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
19	PDB:6jxrm	0.469	0.385	4.466E-7	248	0.085	0.069	6jxrm.pdb.gz
20	PDB:1f6lL	0.401	0.719	6.312E-7	106	0.100	0.189	1f6lL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K4G0	3.13e-151	419	201	1.000	1.000	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
2	Q3U497	2.50e-71	217	209	0.572	0.550	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
3	Q8TDQ1	1.05e-47	159	290	0.393	0.272	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
4	Q8VCH2	1.42e-47	157	221	0.443	0.403	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
5	Q6SJQ5	7.46e-47	156	245	0.453	0.371	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
6	Q6UXZ3	5.27e-45	149	194	0.338	0.351	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
7	Q6SJQ7	2.26e-34	126	337	0.308	0.184	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
8	A0A0K2S4Q6	2.72e-24	96.7	201	0.279	0.279	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
9	Q7TSN2	9.55e-24	95.9	228	0.303	0.268	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
10	Q08708	3.08e-22	92.0	224	0.368	0.330	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
11	Q9UGN4	6.24e-21	90.1	299	0.264	0.177	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
12	Q496F6	1.48e-19	84.3	205	0.269	0.263	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
13	Q6SJQ0	4.22e-16	77.0	318	0.179	0.113	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
14	Q6UXG3	3.31e-15	74.7	332	0.179	0.108	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
15	Q1ERP8	2.78e-12	66.2	331	0.224	0.136	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
16	Q3LRV9	2.40e-08	54.7	263	0.134	0.103	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
17	P01833	2.15e-07	52.8	764	0.134	0.035	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
18	P01832	3.52e-07	52.0	773	0.204	0.053	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
19	P0DMS9	1.04e-06	50.1	266	0.174	0.132	TMIG3_HUMAN Transmembrane domain-containing protein TMIGD3 OS=Homo sapiens OX=9606 GN=TMIGD3 PE=1 SV=1
20	P15083	1.50e-06	50.1	769	0.164	0.043	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	84	14.7	Immunoglobulin I-set domain
2	PF00047 ig	3.7	19.1	Immunoglobulin domain
3	PF13927 Ig_3	18	17.3	Immunoglobulin domain
4	PF07686 V-set	2e-10	52.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376397

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262629	0.940	TYRO protein tyrosine kinase-binding protein
2	9606.ENSP00000244709	0.827	Triggering receptor expressed on myeloid cells 1
3	9606.ENSP00000246551	0.809	Hematopoietic cell signal transducer
4	9606.ENSP00000402855	0.777	Trem-like transcript 1 protein
5	9606.ENSP00000363089	0.758	Toll-like receptor 4
6	9606.ENSP00000342570	0.736	Trem-like transcript 4 protein
7	9606.ENSP00000362205	0.709	Triggering receptor expressed on myeloid cells 2
8	9606.ENSP00000329507	0.705	CMRF35-like molecule 6
9	9606.ENSP00000289902	0.689	High affinity immunoglobulin epsilon receptor subunit gamma
10	9606.ENSP00000462309	0.676	CMRF35-like molecule 1
11	9606.ENSP00000418767	0.671	Trem-like transcript 2 protein
12	9606.ENSP00000274532	0.648	T-cell immunoglobulin and mucin domain-containing protein 4
13	9606.ENSP00000251372	0.647	Leukocyte immunoglobulin-like receptor subfamily A member 1
14	9606.ENSP00000350467	0.642	GCN5 related N-acetyltransferases
15	9606.ENSP00000227163	0.636	Transcription factor PU.1
16	9606.ENSP00000353259	0.635	CMRF35-like molecule 8
17	9606.ENSP00000374125	0.618	Sialic acid-binding Ig-like lectin 15
18	9606.ENSP00000312082	0.573	Toll-like receptor 8
19	9606.ENSP00000449999	0.567	C-type lectin domain family 5 member A
20	9606.ENSP00000433761	0.564	Membrane-spanning 4-domains subfamily A member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.993	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.978	positive regulation of biological process
GO:0051239	0.973	regulation of multicellular organismal process
GO:0051716	0.943	cellular response to stimulus
GO:0002682	0.942	regulation of immune system process
GO:0050865	0.845	regulation of cell activation
GO:0007154	0.829	cell communication
GO:0023052	0.828	signaling
GO:0002684	0.814	positive regulation of immune system process
GO:0007165	0.806	signal transduction
GO:0048583	0.785	regulation of response to stimulus
GO:0002376	0.709	immune system process
GO:0048584	0.617	positive regulation of response to stimulus
GO:0048522	0.548	positive regulation of cellular process
GO:0019222	0.543	regulation of metabolic process
GO:0050776	0.505	regulation of immune response
GO:0002694	0.477	regulation of leukocyte activation
GO:0060255	0.455	regulation of macromolecule metabolic process
GO:0009893	0.315	positive regulation of metabolic process
GO:0048519	0.310	negative regulation of biological process
GO:0032101	0.309	regulation of response to external stimulus
GO:0080134	0.300	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.773	intracellular anatomical structure
GO:0043231	0.747	intracellular membrane-bounded organelle
GO:0005737	0.661	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]