StarFunc result for job id A8K855

User Input

>input (629 residues)
MAISPRSDATFSSQKSTPSESPRTKKFPLTEEEIFYMNCRAAYLTVFKSSLENIISKDQL
YLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDG
CILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDYIKFCKLYMTTNEQCLKTTLE
KLEVDSKLMRHQFGNHIEGSPERDPSPVPKPSPKITRKTDPETFLNKGDTRSSLLSATRK
FKTSVSFTVTMGANGNRNSKLMEPNLIKDWQHMQSKGCFFLEEDGEIISHQYRMQIAQRS
MVYLTIKPLNLSQVEGKPSPWLSVDTALYILKENESQANLQLVCFTELRNREVFGWTGEL
GPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCRENFDTKRNELTRQGFMDLNLMEANDREGDPC
DLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNG
DAKVMDGYENIIVHTYSCDTWITSVIENKSDEKVIIHISNELSKNCINNRGLNIFAVEVG
PKSTMVCQHVMPLNERQEWIYYCIYSLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K855	1.000	1.000	0.000	629	1.000	1.000	A8K855.pdb.gz	EFCB7_HUMAN EF-hand calcium-binding domain-containing protein 7 OS=Homo sapiens OX=9606 GN=EFCAB7 PE=1 SV=1
2	AFDB:Q8VDY4	0.689	0.690	0.000	628	0.827	0.828	Q8VDY4.pdb.gz	EFCB7_MOUSE EF-hand calcium-binding domain-containing protein 7 OS=Mus musculus OX=10090 GN=Efcab7 PE=1 SV=1
3	AFDB:P27398	0.283	0.117	3.721E-12	1594	0.072	0.028	P27398.pdb.gz	CAND_DROME Calpain-D OS=Drosophila melanogaster OX=7227 GN=sol PE=1 SV=2
4	AFDB:O75808	0.331	0.199	3.915E-11	1086	0.067	0.039	O75808.pdb.gz	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
5	AFDB:Q9XVI9	0.190	0.713	7.433E-7	142	0.049	0.218	Q9XVI9.pdb.gz	MLC5_CAEEL Myosin-2 essential light chain OS=Caenorhabditis elegans OX=6239 GN=mlc-5 PE=1 SV=1
6	AFDB:P05976	0.191	0.540	3.084E-6	194	0.056	0.180	P05976.pdb.gz	MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1 PE=1 SV=3
7	AFDB:P54357	0.190	0.670	4.055E-6	147	0.048	0.204	P54357.pdb.gz	MLC2_DROME Myosin-2 essential light chain OS=Drosophila melanogaster OX=7227 GN=Mlc-c PE=1 SV=1
8	AFDB:Q90WC7	0.193	0.551	4.779E-6	193	0.048	0.155	Q90WC7.pdb.gz	Q90WC7_ONCMY Myosin light chain 1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	AFDB:P60660	0.191	0.663	6.636E-6	151	0.043	0.179	P60660.pdb.gz	MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2
10	AFDB:Q6P0G6	0.190	0.545	9.734E-6	190	0.052	0.174	Q6P0G6.pdb.gz	MYL1_DANRE Myosin, light chain 1, alkali; skeletal, fast OS=Danio rerio OX=7955 GN=myl1 PE=2 SV=1
11	PDB:5tbyC	0.192	0.677	2.187E-5	152	0.048	0.197	5tbyC.pdb.gz
12	PDB:3wfnB	0.119	0.373	3.993E-5	169	0.068	0.254	3wfnB.pdb.gz
13	PDB:6b9tD	0.092	0.118	5.546E-5	453	0.065	0.091	6b9tD.pdb.gz	Structural basis for methylphosphonate biosynthesis.
14	PDB:1a2xA	0.102	0.352	1.260E-4	158	0.057	0.228	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
15	PDB:4e53A	0.111	0.333	1.657E-4	168	0.070	0.262	4e53A.pdb.gz
16	PDB:5d43A	0.114	0.371	1.750E-4	150	0.065	0.273	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
17	PDB:2f2pA	0.107	0.327	2.567E-4	169	0.065	0.243	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
18	PDB:2lhiA	0.132	0.315	2.864E-4	176	0.068	0.244	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
19	PDB:5a2hA	0.099	0.358	2.864E-4	147	0.068	0.293	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:1osaA	0.099	0.347	3.978E-4	148	0.060	0.257	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K855	0.0	1313	629	1.000	1.000	EFCB7_HUMAN EF-hand calcium-binding domain-containing protein 7 OS=Homo sapiens OX=9606 GN=EFCAB7 PE=1 SV=1
2	Q8VDY4	0.0	1105	628	0.828	0.830	EFCB7_MOUSE EF-hand calcium-binding domain-containing protein 7 OS=Mus musculus OX=10090 GN=Efcab7 PE=1 SV=1
3	P24044	8.64e-14	71.2	149	0.073	0.309	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
4	P62203	8.64e-14	71.2	149	0.073	0.309	CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CAM PE=1 SV=2
5	P60204	8.11e-13	68.6	149	0.073	0.309	CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=camA PE=1 SV=2
6	P69097	4.22e-12	66.6	149	0.057	0.242	CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=2
7	F4IVN6	1.19e-11	65.9	181	0.065	0.227	F4IVN6_ARATH Calmodulin 5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
8	P04464	1.58e-11	64.7	149	0.075	0.315	CALM_WHEAT Calmodulin OS=Triticum aestivum OX=4565 PE=1 SV=3
9	P0DH95	2.17e-11	64.3	149	0.072	0.302	CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana OX=3702 GN=CAM1 PE=1 SV=1
10	F4IJ46	5.67e-11	63.5	161	0.067	0.261	F4IJ46_ARATH Calmodulin 2 OS=Arabidopsis thaliana OX=3702 GN=CAM2 PE=4 SV=1
11	Q9JM83	7.23e-11	62.8	148	0.073	0.311	CALM4_MOUSE Calmodulin-4 OS=Mus musculus OX=10090 GN=Calm4 PE=2 SV=2
12	A0A1D8PMF8	8.22e-11	62.8	149	0.065	0.275	A0A1D8PMF8_CANAL Calmodulin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CMD1 PE=4 SV=1
13	F4IEU4	8.95e-11	62.8	159	0.062	0.245	F4IEU4_ARATH Calmodulin 4 OS=Arabidopsis thaliana OX=3702 GN=CAM4 PE=4 SV=1
14	P13868	9.13e-11	62.8	149	0.072	0.302	CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum OX=4113 GN=PCM1 PE=1 SV=2
15	P0DH97	1.02e-10	62.4	149	0.065	0.275	CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana OX=3702 GN=CAM2 PE=1 SV=1
16	P0DH98	1.02e-10	62.4	149	0.065	0.275	CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana OX=3702 GN=CAM3 PE=1 SV=1
17	Q682T9	1.02e-10	62.4	149	0.065	0.275	CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
18	P59220	1.05e-10	62.4	149	0.065	0.275	CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana OX=3702 GN=CAM7 PE=1 SV=2
19	P62199	1.05e-10	62.4	149	0.065	0.275	CALM1_PETHY Calmodulin-1 OS=Petunia hybrida OX=4102 GN=CAM81 PE=1 SV=2
20	F4K8M2	1.58e-10	62.8	175	0.062	0.223	F4K8M2_ARATH Calmodulin 1 OS=Arabidopsis thaliana OX=3702 GN=CAM1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00404 Dockerin_1	2.7e+02	13.2	Dockerin type I domain
2	PF08942 DUF1919	1.1e+02	13.8	Domain of unknown function (DUF1919)
3	PF11284 DUF3085	5.7e+02	12.2	Protein of unknown function (DUF3085)
4	PF16232 DUF4891	2.6e+02	13.6	Domain of unknown function (DUF4891)
5	PF00036 EF-hand_1	0.00012	32.5	EF hand
6	PF12763 EF-hand_4	0.23	22.8	Cytoskeletal-regulatory complex EF hand
7	PF13202 EF-hand_5	0.32	21.8	EF hand
8	PF13405 EF-hand_6	0.0071	27.1	EF-hand domain
9	PF13499 EF-hand_7	1.4e-10	52.8	EF-hand domain pair
10	PF13833 EF-hand_8	0.014	26.4	EF-hand domain pair
11	PF08726 EFhand_Ca_insen	2.8e+02	13.0	Ca2+ insensitive EF hand
12	PF08356 EF_assoc_2	99	14.4	EF hand associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480715	0.991	IQ domain-containing protein E
2	9606.ENSP00000342144	0.919	Limbin
3	9606.ENSP00000264956	0.873	Ellis-van Creveld syndrome protein
4	9606.ENSP00000360485	0.791	A-kinase anchor protein 14
5	9606.ENSP00000432305	0.783	Sperm surface protein Sp17
6	9606.ENSP00000216218	0.683	Hsc70-interacting protein
7	9606.ENSP00000219611	0.659	Calpain-15
8	9606.ENSP00000377690	0.627	Participates positively in the ciliary Hedgehog (Hh) signaling
9	9606.ENSP00000353590	0.621	Myosin-10
10	9606.ENSP00000298875	0.614	Cleavage and polyadenylation specificity factor subunit 2
11	9606.ENSP00000343366	0.582	V-set and transmembrane domain-containing protein 1
12	9606.ENSP00000262103	0.568	EF-hand calcium-binding domain-containing protein 1
13	9606.ENSP00000347648	0.565	Zinc finger protein 512
14	9606.ENSP00000322238	0.562	Uncharacterized protein C14orf119
15	9606.ENSP00000404232	0.556	EF-hand domain-containing family member C2
16	9606.ENSP00000221418	0.535	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
17	9606.ENSP00000356379	0.522	Abnormal spindle-like microcephaly-associated protein
18	9606.ENSP00000360124	0.518	Phosphoglucomutase-1
19	9606.ENSP00000303942	0.511	Platelet glycoprotein IX
20	9606.ENSP00000334553	0.509	Peptidyl-prolyl cis-trans isomerase-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.971	biological regulation
GO:0050794	0.964	regulation of cellular process
GO:0060255	0.911	regulation of macromolecule metabolic process
GO:0031323	0.887	regulation of cellular metabolic process
GO:0032879	0.873	regulation of localization
GO:0060341	0.859	regulation of cellular localization
GO:0048518	0.857	positive regulation of biological process
GO:0048522	0.787	positive regulation of cellular process
GO:0009987	0.786	cellular process
GO:0051171	0.775	regulation of nitrogen compound metabolic process
GO:0080090	0.712	regulation of primary metabolic process
GO:0009893	0.711	positive regulation of metabolic process
GO:0032386	0.711	regulation of intracellular transport
GO:0032880	0.675	regulation of protein localization
GO:0051173	0.533	positive regulation of nitrogen compound metabolic process
GO:0010604	0.410	positive regulation of macromolecule metabolic process
GO:0010468	0.408	regulation of gene expression
GO:0031326	0.385	regulation of cellular biosynthetic process
GO:0019219	0.373	regulation of nucleobase-containing compound metabolic process
GO:0051050	0.368	positive regulation of transport
GO:0010556	0.366	regulation of macromolecule biosynthetic process
GO:0031325	0.358	positive regulation of cellular metabolic process
GO:1903829	0.344	positive regulation of protein localization
GO:1904375	0.328	regulation of protein localization to cell periphery
GO:0051252	0.326	regulation of RNA metabolic process
GO:0032388	0.325	positive regulation of intracellular transport
GO:0051222	0.325	positive regulation of protein transport
GO:0045893	0.322	positive regulation of DNA-templated transcription
GO:0033157	0.315	regulation of intracellular protein transport
GO:0046822	0.312	regulation of nucleocytoplasmic transport
GO:0090316	0.300	positive regulation of intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.999	cilium
GO:0016020	0.966	membrane
GO:0005886	0.931	plasma membrane
GO:0032991	0.840	protein-containing complex
GO:0005622	0.822	intracellular anatomical structure
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0005737	0.699	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]