StarFunc result for job id A8K8P3

User Input

>input (1242 residues)
MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRR
ELPSTSHLVQYRGTHTCTRQGRLRELRIRCVARKFLYLWIRMTFGRVFPSKARFYYEQRL
LRKVFEEWKEEWWVFQHEWKLCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEV
HDAKQKMRQAWKSWLIYVVVRRTKLQMQTTALEFRQRIILRVWWSTWRQRLGQVRVSRAL
HASALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKHHQHWQKRRFLKAWLEYLQVR
RVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKMALRRAFTHWK
HYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHR
FWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGH
FQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRETLEKQVFSLWRQKMFQHRENRLAE
RMAILHAERQLLYRSWFMWHQQAAARHQEQEWQTVACAHHRHGRLKKAFCLWRESAQGLR
TERTGRVRAAEFHMAQLLRWAWSQWRECLALRGAERQKLMRADLHHQHSVLHRALQAWVT
YQGRVRSILREVAARESQHNRQLLRGALRRWKENTMARVDEAKKTFQASTHYRRTICSKV
LVQWREAVSVQMYYRQQEDCAIWEAQKVLDRGCLRTWFQRWWDCSRRSAQQRLQLERAVQ
HHHRQLLLEGLARWKTHHLQCVRKRLLHRQSTQLLAQRLSRTCFRQWRQQLAARRQEQRA
TVRALWFWAFSLQAKVWATWLAFVLERRRKKARLQWALQAYQGQLLQEGATRLLRFAASM
KASRQQLQAQQQVQAAHSLHRAVRRCATLWKQKVLGRGGKPQPLAAIAPSRKVTFEGPLL
NRIAAGAGDGTLETKRPQASRPLGALGRLAAEEPHALELNTAHSARKQPRRPHFLLEPAQ
SQRPQKPQEHGLGMAQPAAPSLTRPFLAEAPTALVPHSPLPGALSSAPGPKQPPTASTGP
ELLLLPLSSFMPCGAAAPARVSAQRATPRDKPPVPSSLASVPDPHLLLPGDFSATRAGPG
LSTAGSLDLEAELEEIQQQLLHYQTTKQNLWSCRRQASSLRRWLELNREEPGPEDQEVEQ
QVQKELEQVEMQIQLLAEELQAQRQPIGACVARIQALRQALC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K8P3	1.000	1.000	0.000	1242	1.000	1.000	A8K8P3.pdb.gz	SFI1_HUMAN Protein SFI1 homolog OS=Homo sapiens OX=9606 GN=SFI1 PE=1 SV=2
2	AFDB:Q9LUI2	0.092	0.071	2.566E-5	1728	0.129	0.093	Q9LUI2.pdb.gz	NET1A_ARATH Protein NETWORKED 1A OS=Arabidopsis thaliana OX=3702 GN=NET1A PE=1 SV=1
3	AFDB:A1Z8P9	0.063	0.039	2.740E-5	2346	0.142	0.075	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
4	AFDB:F4JIF4	0.081	0.061	6.844E-5	1710	0.127	0.092	F4JIF4.pdb.gz	NET1B_ARATH Protein NETWORKED 1B OS=Arabidopsis thaliana OX=3702 GN=NET1B PE=2 SV=1
5	AFDB:Q9CS72	0.058	0.059	1.013E-4	1211	0.146	0.149	Q9CS72.pdb.gz	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
6	AFDB:Q54JG6	0.075	0.052	2.080E-4	2037	0.134	0.082	Q54JG6.pdb.gz	Q54JG6_DICDI Nucleoprotein TPR/MLP1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288073 PE=4 SV=1
7	AFDB:F3Y5P4	0.100	0.095	3.747E-4	1319	0.150	0.141	F3Y5P4.pdb.gz	GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=6239 GN=grdn-1 PE=1 SV=1
8	AFDB:F6ZDS4	0.067	0.039	5.922E-4	2431	0.157	0.080	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
9	AFDB:Q5EE04	0.071	0.051	6.323E-4	1997	0.155	0.096	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
10	AFDB:Q4L180	0.064	0.069	6.750E-4	1135	0.143	0.157	Q4L180.pdb.gz	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
11	PDB:2zdiB	0.067	0.663	9.685E-2	106	0.014	0.160	2zdiB.pdb.gz
12	PDB:7z37DP1	0.071	0.298	2.583E-1	273	0.013	0.059	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
13	PDB:3c98B	0.054	0.227	2.944E-1	230	0.010	0.057	3c98B.pdb.gz
14	PDB:7vvuV	0.063	0.518	2.944E-1	113	0.013	0.142	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
15	PDB:3ajwA	0.075	0.589	3.824E-1	134	0.013	0.119	3ajwA.pdb.gz
16	PDB:7rroA0	0.071	0.350	3.824E-1	221	0.015	0.086	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7ungD3	0.071	0.255	4.967E-1	317	0.015	0.060	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:3lssA	0.058	0.162	5.661E-1	438	0.006	0.018	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
19	PDB:6tuyA	0.060	0.107	6.043E-1	667	0.010	0.018	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:7nsuD	0.068	0.189	6.452E-1	420	0.007	0.021	7nsuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K8P3	0.0	2503	1242	1.000	1.000	SFI1_HUMAN Protein SFI1 homolog OS=Homo sapiens OX=9606 GN=SFI1 PE=1 SV=2
2	Q9Y6V0	8.19e-04	46.6	5142	0.048	0.012	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
3	Q9JKS6	0.007	43.5	5085	0.036	0.009	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
4	Q8BRH4	0.079	40.0	4903	0.041	0.010	KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2
5	Q68FY1	0.081	39.3	325	0.023	0.086	NUP35_RAT Nucleoporin NUP35 OS=Rattus norvegicus OX=10116 GN=Nup35 PE=1 SV=1
6	Q6P9X9	0.11	38.5	296	0.023	0.095	PARM1_RAT Prostate androgen-regulated mucin-like protein 1 homolog OS=Rattus norvegicus OX=10116 GN=Parm1 PE=1 SV=1
7	Q9V9X1	0.18	38.5	774	0.019	0.030	Q9V9X1_DROME Morpheyus, isoform A OS=Drosophila melanogaster OX=7227 GN=mey PE=4 SV=3
8	Q57U44	0.22	38.1	705	0.035	0.062	Q57U44_TRYB2 Sfi1 spindle body domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.280 PE=4 SV=1
9	A0A8I6A4Z1	0.30	38.1	5003	0.023	0.006	A0A8I6A4Z1_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
10	A0A8I6G4C0	0.30	38.1	4986	0.023	0.006	A0A8I6G4C0_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
11	A0A8I6A900	0.31	38.1	4946	0.023	0.006	A0A8I6A900_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
12	A0A8I6A825	0.34	37.7	4952	0.023	0.006	A0A8I6A825_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
13	Q9LY91	0.42	35.4	150	0.012	0.100	AGP6_ARATH Classical arabinogalactan protein 6 OS=Arabidopsis thaliana OX=3702 GN=AGP6 PE=2 SV=1
14	M9PB30	0.50	37.4	22949	0.022	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
15	M9PB31	0.50	37.4	20404	0.022	0.001	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PBZ0	0.50	37.4	22830	0.022	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PC41	0.50	37.4	22743	0.022	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC45	0.50	37.4	22300	0.022	0.001	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PC48	0.50	37.4	18095	0.022	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PCJ6	0.50	37.4	18641	0.022	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359300	0.994	Centrin-2
2	9606.ENSP00000428259	0.981	Centrin-3
3	9606.ENSP00000319052	0.956	Centrin-1
4	9606.ENSP00000328426	0.722	Protein FAM208B
5	9606.ENSP00000261965	0.714	Gamma-tubulin complex component 3
6	9606.ENSP00000410216	0.708	Centrosomal protein POC5
7	9606.ENSP00000446093	0.692	Gamma-tubulin complex component 2
8	9606.ENSP00000296029	0.626	Platelet factor 4
9	9606.ENSP00000314615	0.591	ADP-ribosylation factor GTPase-activating protein 1
10	9606.ENSP00000380559	0.586	Crm, cramped-like (Drosophila)
11	9606.ENSP00000389843	0.569	Sodium-coupled neutral amino acid transporter 4
12	9606.ENSP00000354916	0.562	Dual specificity protein phosphatase CDC14A
13	9606.ENSP00000254227	0.558	Nuclear receptor subfamily 0 group B member 2
14	9606.ENSP00000317790	0.552	Spectrin beta, non-erythrocytic 5
15	9606.ENSP00000360054	0.552	Phosphatase and actin regulator 3
16	9606.ENSP00000320949	0.547	CCR4-NOT transcription complex subunit 1
17	9606.ENSP00000316357	0.541	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
18	9606.ENSP00000360532	0.534	Cell division cycle 5-like protein
19	9606.ENSP00000436848	0.514	LBH domain-containing protein 1
20	9606.ENSP00000270861	0.512	Serine/threonine-protein kinase PLK4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071840	0.942	cellular component organization or biogenesis
GO:0065007	0.931	biological regulation
GO:0016043	0.917	cellular component organization
GO:0050789	0.867	regulation of biological process
GO:0050794	0.806	regulation of cellular process
GO:0070925	0.753	organelle assembly
GO:0007010	0.322	cytoskeleton organization
GO:0000226	0.306	microtubule cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.929	organelle
GO:0043229	0.924	intracellular organelle
GO:0043227	0.898	membrane-bounded organelle
GO:0043232	0.876	intracellular non-membrane-bounded organelle
GO:0043231	0.757	intracellular membrane-bounded organelle
GO:0005815	0.684	microtubule organizing center
GO:0031974	0.331	membrane-enclosed lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]