StarFunc result for job id A8K979

User Input

>input (691 residues)
MATKRLARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIE
FPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW
IHKIQQQKNIIFATGISEPSASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWI
DLRATYKLFYRRKPKGLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITR
SLNKVPTKKNFSILARNLNTIQVEEMSACNISIQGPSIYNKEPKNIINPHEKVQMKSICA
NSPIKAQQDQLQVKNNIKASLHNVKSSLPLFNTKSSTSVGQLQSPTLNSPIYMQKQGKNE
HLAFNTKSKASTVGSELVLVSTTVPTVHHVSDLEMSSTLDCLPVLADWEDVVLLPASQPE
ENVDCTVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPH
TTIYNVKEAKDPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGGTKRNPCSPQ
AFPPAKKQPFTIHEEKPTSSDCSPVRSSSWRRLPSILTSTVNLQEPWKSGKMTPPLCKCG
RRSKRLVVSNNGPNHGKVFYCCPIGKYQENRKCCGYFKWEQTLQKERANSMVPSHSTGGL
TFSSPETSHICDRNLSISTKNSLRLRPSMRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1zbuB	0.271	0.599	7.634E-19	304	0.110	0.250	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
2	PDB:3cg7A	0.256	0.579	1.335E-14	296	0.077	0.179	3cg7A.pdb.gz	Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
3	PDB:3v9xB	0.222	0.645	3.481E-8	212	0.064	0.208	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
4	PDB:3u3yB	0.214	0.608	2.253E-6	220	0.046	0.145	3u3yB.pdb.gz	Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
5	PDB:1y97A	0.222	0.633	3.221E-6	214	0.041	0.131	1y97A.pdb.gz
6	PDB:4gmjB	0.209	0.487	4.887E-6	264	0.045	0.117	4gmjB.pdb.gz	The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
7	PDB:2p51A	0.226	0.548	6.987E-6	255	0.049	0.133	2p51A.pdb.gz	The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
8	PDB:4js4A	0.201	0.287	2.919E-5	468	0.045	0.066	4js4A.pdb.gz	Crystal structures of Escherichia coli exonuclease I in complex with single-stranded DNA provide insights into the mechanism of processive digestion.
9	PDB:3c95A	0.189	0.280	7.133E-5	446	0.046	0.072	3c95A.pdb.gz
10	PDB:2igiA	0.177	0.554	1.547E-4	180	0.048	0.183	2igiA.pdb.gz	Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli
11	AFDB:Q8CGF1	0.056	0.050	3.131E-2	1266	0.114	0.062	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
12	AFDB:Q9U489	0.088	0.062	2.236E-1	1147	0.109	0.065	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
13	AFDB:A6MHQ4	0.054	0.056	2.518E-1	658	0.114	0.120	A6MHQ4.pdb.gz	NKAIN_DROME Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Drosophila melanogaster OX=7227 GN=NKAIN PE=1 SV=1
14	AFDB:Q9UPX6	0.054	0.044	3.392E-1	916	0.114	0.086	Q9UPX6.pdb.gz	MNAR1_HUMAN Major intrinsically disordered Notch2-binding receptor 1 OS=Homo sapiens OX=9606 GN=MINAR1 PE=1 SV=3
15	AFDB:F4IDQ6	0.055	0.030	8.290E-1	1576	0.113	0.049	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
16	AFDB:Q5RFW2	0.068	0.067	1.335	711	0.091	0.089	Q5RFW2.pdb.gz	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
17	AFDB:Q9M9N3	0.053	0.049	1.417	769	0.110	0.099	Q9M9N3.pdb.gz	Q9M9N3_ARATH T17B22.17 protein OS=Arabidopsis thaliana OX=3702 GN=PWO1 PE=1 SV=1
18	AFDB:Q9UPP1	0.073	0.052	1.417	1060	0.114	0.075	Q9UPP1.pdb.gz	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
19	AFDB:A7Y7X5	0.053	0.052	1.596	761	0.078	0.071	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
20	AFDB:Q5RGX4	0.073	0.073	1.694	685	0.104	0.105	Q5RGX4.pdb.gz	Q5RGX4_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q95RQ4	5.83e-61	207	281	0.136	0.335	ERI2_DROME 3'-5' exonuclease Snipper OS=Drosophila melanogaster OX=7227 GN=Snp PE=1 SV=1
2	Q7TMF2	1.22e-40	154	345	0.116	0.232	ERI1_MOUSE 3'-5' exoribonuclease 1 OS=Mus musculus OX=10090 GN=Eri1 PE=1 SV=2
3	Q54RJ2	1.81e-39	147	220	0.123	0.386	Q54RJ2_DICDI Exonuclease domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=eriA PE=4 SV=1
4	Q8IV48	6.31e-37	143	349	0.110	0.218	ERI1_HUMAN 3'-5' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=ERI1 PE=1 SV=3
5	Q9TZZ9	2.50e-31	125	266	0.117	0.305	Q9TZZ9_CAEEL Exonuclease domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_R02D3.8 PE=1 SV=1
6	Q580W2	3.40e-31	129	452	0.116	0.177	Q580W2_TRYB2 Exonuclease domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.80 PE=4 SV=1
7	O43414	1.12e-30	125	337	0.113	0.231	ERI3_HUMAN ERI1 exoribonuclease 3 OS=Homo sapiens OX=9606 GN=ERI3 PE=1 SV=2
8	Q580W0	1.56e-30	124	291	0.119	0.282	Q580W0_TRYB2 Exonuclease, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.180 PE=4 SV=1
9	Q8C460	1.65e-30	125	337	0.113	0.231	ERI3_MOUSE ERI1 exoribonuclease 3 OS=Mus musculus OX=10090 GN=Eri3 PE=1 SV=1
10	O44406	2.06e-29	125	582	0.130	0.155	ERI1_CAEEL 3'-5' exonuclease eri-1 OS=Caenorhabditis elegans OX=6239 GN=eri-1 PE=1 SV=2
11	Q08I43	2.47e-23	103	313	0.104	0.230	ERI1_SCHPO 3'-5' exonuclease eri1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eri1 PE=1 SV=1
12	Q385M0	1.69e-20	98.2	540	0.109	0.139	Q385M0_TRYB2 2'-phosphotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3160 PE=3 SV=1
13	Q8W566	3.97e-20	94.4	337	0.094	0.193	Y3514_ARATH Uncharacterized exonuclease domain-containing protein At3g15140 OS=Arabidopsis thaliana OX=3702 GN=At3g15140 PE=2 SV=1
14	Q10905	1.12e-13	74.7	298	0.090	0.208	CRN4_CAEEL 3'-5' exonuclease crn-4 OS=Caenorhabditis elegans OX=6239 GN=crn-4 PE=1 SV=1
15	Q9NG98	5.71e-06	52.4	1250	0.032	0.018	TOP3A_DROME DNA topoisomerase 3-alpha OS=Drosophila melanogaster OX=7227 GN=Top3alpha PE=2 SV=2
16	A0A1L8HU22	0.001	44.7	616	0.029	0.032	NEIL3_XENLA Endonuclease 8-like 3 OS=Xenopus laevis OX=8355 GN=neil3 PE=1 SV=1
17	Q8TAT5	0.001	44.7	605	0.027	0.031	NEIL3_HUMAN Endonuclease 8-like 3 OS=Homo sapiens OX=9606 GN=NEIL3 PE=1 SV=3
18	O70157	0.002	44.3	1003	0.041	0.028	TOP3A_MOUSE DNA topoisomerase 3-alpha OS=Mus musculus OX=10090 GN=Top3a PE=2 SV=1
19	Q8K203	0.006	42.4	606	0.027	0.031	NEIL3_MOUSE Endonuclease 8-like 3 OS=Mus musculus OX=10090 GN=Neil3 PE=1 SV=1
20	Q13472	0.43	36.6	1001	0.026	0.018	TOP3A_HUMAN DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16500 Cyclin_N2	5.7e+02	12.7	Cyclin-A N-terminal APC/C binding region
2	PF00929 RNase_T	1e-22	93.0	Exonuclease
3	PF06839 zf-GRF	6.9e-14	63.0	GRF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366396	0.914	5'-3' exoribonuclease 2
2	9606.ENSP00000437256	0.769	Endoribonuclease Dicer
3	9606.ENSP00000454562	0.722	Deoxyribonuclease-1-like 2
4	9606.ENSP00000216237	0.696	Lethal(3)malignant brain tumor-like protein 2
5	9606.ENSP00000463334	0.690	MIF4G domain-containing protein
6	9606.ENSP00000364498	0.683	Decapping and exoribonuclease protein
7	9606.ENSP00000323424	0.643	Interferon-stimulated 20 kDa exonuclease-like 2
8	9606.ENSP00000361522	0.643	Tight junction associated protein 1
9	9606.ENSP00000402653	0.624	WD repeat domain-containing protein 83
10	9606.ENSP00000253363	0.613	RNA-binding protein 39
11	9606.ENSP00000287202	0.605	CUGBP Elav-like family member 6
12	9606.ENSP00000390621	0.576	Putative ATP-dependent RNA helicase TDRD12
13	9606.ENSP00000415056	0.556	piRNA biogenesis protein EXD1
14	9606.ENSP00000378505	0.555	Dual specificity protein kinase CLK3
15	9606.ENSP00000372459	0.545	CBP80/20-dependent translation initiation factor
16	9606.ENSP00000266022	0.524	RNA-binding protein 6
17	9606.ENSP00000414921	0.524	Polypyrimidine tract-binding protein 3
18	9606.ENSP00000425979	0.519	Ribonuclease 3
19	9606.ENSP00000454926	0.517	Uncharacterized protein C16orf52
20	9606.ENSP00000319222	0.514	Putative protein ZNF720

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140640	1.000	catalytic activity, acting on a nucleic acid
GO:0005515	1.000	protein binding
GO:0008408	0.997	3'-5' exonuclease activity
GO:0003676	0.994	nucleic acid binding
GO:0140097	0.982	catalytic activity, acting on DNA
GO:0140098	0.973	catalytic activity, acting on RNA
GO:0004536	0.738	deoxyribonuclease activity
GO:0016796	0.674	exonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
GO:0004540	0.632	ribonuclease activity
GO:0003677	0.526	DNA binding
GO:0003697	0.396	single-stranded DNA binding
GO:0016895	0.384	DNA exonuclease activity, producing 5'-phosphomonoesters
GO:0008296	0.301	3'-5'-DNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.998	macromolecule metabolic process
GO:0006139	0.997	nucleobase-containing compound metabolic process
GO:0090304	0.989	nucleic acid metabolic process
GO:0016070	0.815	RNA metabolic process
GO:0065007	0.814	biological regulation
GO:0050789	0.783	regulation of biological process
GO:0044260	0.753	cellular macromolecule metabolic process
GO:0050794	0.578	regulation of cellular process
GO:0010467	0.439	gene expression
GO:0019222	0.419	regulation of metabolic process
GO:0060255	0.325	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.958	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
EC:3.1.15.-	0.674	Exonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.
EC:3.1.11.-	0.384	Exodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]