StarFunc result for job id A8MPP1

User Input

>input (907 residues)
MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALS
WLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQK
KEERDLVDRLKVEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEETENLLRLSREMLET
GPEAERLEQLESGEEELVLAEYESDEEKKVASGHRVDEDEDDLEEEHITKIYHCSRTHSQ
LAQFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVRSLGSVQLINDRCVDMQRSRHEKKKG
AEEEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLLALGKEARACPYYRSRLA
IPAAKLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDTITGMHSVEVSGSQLCQA
HSQLLQYMERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQTGTELKTI
NDFLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQ
PRTTEALAAPADESQASVPQPASPLMHIEGFLAALTTANQDGRVILSRQGSLSESTLKFL
LLNPAVHFAQVVKECRAVVIAGGTMQPVSDFRQQLLACAGVEAERVVEFSCGHVIPPDNI
PLVICSGISNQPLEFTFQKRDLPQMMDEVGRILCNLCGVVSGGVVCFFSSYEYLRQVHAH
WEKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTEALLLSVVGGKM
SEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPRAPGQAPPGKALVENLCMK
AVNQSIGRAIRHQKDFASIVLLDQRYARPPVLAKLPAWIRASVEVKATFGPAIAAVQKFH
REKSASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R345	0.904	0.921	0.000	890	0.595	0.607	F1R345.pdb.gz	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
2	AFDB:Q96FC9	0.865	0.810	0.000	970	0.884	0.827	Q96FC9.pdb.gz	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
3	AFDB:Q9CA92	0.734	0.755	3.283E-72	882	0.344	0.354	Q9CA92.pdb.gz	Q9CA92_ARATH DNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g79890 PE=1 SV=1
4	AFDB:Q21489	0.772	0.841	3.456E-72	830	0.318	0.347	Q21489.pdb.gz	CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2
5	AFDB:O14147	0.772	0.827	3.977E-69	844	0.342	0.367	O14147.pdb.gz	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
6	AFDB:P22516	0.726	0.762	5.073E-66	861	0.322	0.339	P22516.pdb.gz	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
7	AFDB:Q38BP4	0.674	0.583	1.783E-55	1056	0.289	0.248	Q38BP4.pdb.gz	Q38BP4_TRYB2 DNA repair helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3870 PE=4 SV=1
8	AFDB:Q9BX63	0.624	0.461	4.495E-51	1249	0.236	0.171	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
9	AFDB:Q5SXJ3	0.639	0.502	7.518E-51	1174	0.241	0.187	Q5SXJ3.pdb.gz	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
10	AFDB:Q3YK19	0.653	0.480	1.258E-50	1252	0.252	0.183	Q3YK19.pdb.gz	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
11	PDB:7ad8B	0.638	0.845	1.232E-35	675	0.197	0.265	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:7lbmX	0.619	0.731	1.788E-34	760	0.201	0.239	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
13	PDB:7k010	0.602	0.715	2.595E-33	754	0.183	0.220	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
14	PDB:5fmfY	0.456	0.686	9.366E-25	578	0.122	0.192	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
15	PDB:6fwrA	0.498	0.631	2.687E-22	699	0.115	0.149	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
16	PDB:5svaY	0.443	0.684	8.334E-22	562	0.132	0.214	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:3crvA	0.396	0.607	6.869E-21	551	0.105	0.172	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
18	PDB:3crw1	0.355	0.615	3.251E-15	485	0.094	0.175	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
19	PDB:6goxA	0.201	0.225	3.684E-5	777	0.076	0.089	6goxA.pdb.gz
20	PDB:2vdaA	0.206	0.221	6.163E-5	828	0.094	0.103	2vdaA.pdb.gz	Structural Basis for Signal-Sequence Recognition by the Translocase Motor Seca as Determined by NMR

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MPP1	0.0	1869	907	1.000	1.000	D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens OX=9606 GN=DDX11L8 PE=1 SV=1
2	F1R345	0.0	1080	890	0.596	0.608	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
3	Q96FC9	0.0	1630	970	0.886	0.829	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
4	C9K0E8	3.24e-175	511	302	0.322	0.967	C9K0E8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=2
5	O14147	1.68e-170	519	844	0.352	0.378	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
6	Q9CA92	5.61e-164	503	882	0.364	0.374	Q9CA92_ARATH DNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g79890 PE=1 SV=1
7	F5GXJ8	1.84e-148	439	224	0.244	0.987	F5GXJ8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
8	Q21489	4.02e-144	449	830	0.336	0.367	CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2
9	P22516	5.08e-139	437	861	0.335	0.353	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
10	F5GXL6	1.59e-104	323	191	0.170	0.806	F5GXL6_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=8
11	A0A0G2K475	1.50e-79	282	1166	0.269	0.209	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
12	Q3YK19	2.01e-71	259	1252	0.280	0.203	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
13	Q5SXJ3	4.98e-69	252	1174	0.215	0.166	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
14	Q9BX63	1.89e-67	248	1249	0.211	0.153	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
15	Q38BP4	5.56e-62	230	1056	0.254	0.218	Q38BP4_TRYB2 DNA repair helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3870 PE=4 SV=1
16	Q9NZ71	1.59e-58	220	1219	0.208	0.155	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
17	F4HUN4	4.64e-55	209	1175	0.204	0.157	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
18	R4GNE1	9.34e-55	186	91	0.098	0.978	R4GNE1_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=1
19	F4HQE2	1.09e-49	192	1040	0.190	0.165	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1
20	Q55G81	3.92e-44	174	776	0.181	0.211	ERCC2_DICDI General transcription and DNA repair factor IIH helicase subunit XPD OS=Dictyostelium discoideum OX=44689 GN=repD PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06733 DEAD_2	2.2e-51	185.5	DEAD_2
2	PF06777 HBB	0.73	21.0	Helical and beta-bridge domain
3	PF13307 Helicase_C_2	8.2e-51	184.0	Helicase C-terminal domain
4	PF02562 PhoH	2.3e+02	12.7	PhoH-like protein
5	PF04851 ResIII	7.7	18.0	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003551

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010263	0.861	CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)
2	61853.ENSNLEP00000003783	0.854	Flap endonuclease 1
3	61853.ENSNLEP00000007107	0.809	ATPase family, AAA domain containing 5
4	61853.ENSNLEP00000014614	0.798	Werner syndrome, RecQ helicase-like
5	61853.ENSNLEP00000006066	0.776	DNA replication and sister chromatid cohesion 1
6	61853.ENSNLEP00000015520	0.754	WD repeat and HMG-box DNA binding protein 1
7	61853.ENSNLEP00000008308	0.742	Establishment of sister chromatid cohesion N-acetyltransferase 1
8	61853.ENSNLEP00000021231	0.736	Timeless circadian clock
9	61853.ENSNLEP00000019016	0.721	ERCC excision repair 3, TFIIH core complex helicase subunit
10	61853.ENSNLEP00000002186	0.715	GEN1 Holliday junction 5' flap endonuclease
11	61853.ENSNLEP00000020760	0.707	Replication factor C (activator 1) 1, 145kDa
12	61853.ENSNLEP00000020060	0.700	Establishment of sister chromatid cohesion N-acetyltransferase 2
13	61853.ENSNLEP00000005335	0.698	Uncharacterized protein
14	61853.ENSNLEP00000015666	0.692	Plays an important role in the control of DNA replication and the maintenance of replication fork stability.
15	61853.ENSNLEP00000018841	0.691	Structural maintenance of chromosomes 3
16	61853.ENSNLEP00000006799	0.690	General transcription factor IIH subunit 4
17	61853.ENSNLEP00000016742	0.690	MNAT CDK-activating kinase assembly factor 1
18	61853.ENSNLEP00000021572	0.688	General transcription factor IIH, polypeptide 1, 62kDa
19	61853.ENSNLEP00000002325	0.685	General transcription factor IIH, polypeptide 3, 34kDa
20	61853.ENSNLEP00000014129	0.685	F-box protein, helicase, 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003678	1.000	DNA helicase activity
GO:0043139	0.936	5'-3' DNA helicase activity
GO:1901363	0.881	heterocyclic compound binding
GO:0097159	0.881	organic cyclic compound binding
GO:0003676	0.637	nucleic acid binding
GO:0003677	0.424	DNA binding
GO:0003682	0.388	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0008152	0.950	metabolic process
GO:0048518	0.946	positive regulation of biological process
GO:0048522	0.941	positive regulation of cellular process
GO:0009987	0.938	cellular process
GO:0071704	0.935	organic substance metabolic process
GO:0044238	0.931	primary metabolic process
GO:0044237	0.930	cellular metabolic process
GO:0006807	0.912	nitrogen compound metabolic process
GO:0043170	0.904	macromolecule metabolic process
GO:0090304	0.883	nucleic acid metabolic process
GO:0019222	0.869	regulation of metabolic process
GO:0031323	0.762	regulation of cellular metabolic process
GO:0050896	0.583	response to stimulus
GO:0044260	0.571	cellular macromolecule metabolic process
GO:0051716	0.521	cellular response to stimulus
GO:0006950	0.509	response to stress
GO:0071840	0.503	cellular component organization or biogenesis
GO:0051171	0.495	regulation of nitrogen compound metabolic process
GO:0080090	0.493	regulation of primary metabolic process
GO:0019219	0.457	regulation of nucleobase-containing compound metabolic process
GO:0006259	0.421	DNA metabolic process
GO:0060255	0.402	regulation of macromolecule metabolic process
GO:0016043	0.398	cellular component organization
GO:0033554	0.377	cellular response to stress
GO:0006974	0.373	cellular response to DNA damage stimulus
GO:0051276	0.363	chromosome organization
GO:0010468	0.308	regulation of gene expression
GO:0006260	0.301	DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.977	protein-containing complex
GO:0005694	0.740	chromosome
GO:0005737	0.529	cytoplasm
GO:0005815	0.526	microtubule organizing center
GO:0005730	0.389	nucleolus
GO:0005829	0.343	cytosol
GO:0140513	0.340	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.936	DNA 5'-3' helicase.

[back to server]