StarFunc result for job id A8MPY1

User Input

>input (467 residues)
MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQK
YEQLLHIEDNDFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
FPSTANKSMTFDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFS
ASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARV
SLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEER
KQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MPY1	1.000	1.000	1.100E-85	467	1.000	1.000	A8MPY1.pdb.gz	GBRR3_HUMAN Gamma-aminobutyric acid receptor subunit rho-3 OS=Homo sapiens OX=9606 GN=GABRR3 PE=3 SV=2
2	AFDB:P50573	0.837	0.842	1.837E-73	464	0.839	0.845	P50573.pdb.gz	GBRR3_RAT Gamma-aminobutyric acid receptor subunit rho-3 OS=Rattus norvegicus OX=10116 GN=Gabrr3 PE=1 SV=1
3	AFDB:P28476	0.772	0.775	5.687E-61	465	0.589	0.591	P28476.pdb.gz	GBRR2_HUMAN Gamma-aminobutyric acid receptor subunit rho-2 OS=Homo sapiens OX=9606 GN=GABRR2 PE=2 SV=5
4	AFDB:P50572	0.752	0.732	1.475E-60	480	0.606	0.590	P50572.pdb.gz	GBRR1_RAT Gamma-aminobutyric acid receptor subunit rho-1 OS=Rattus norvegicus OX=10116 GN=Gabrr1 PE=1 SV=2
5	AFDB:Q5TZ16	0.757	0.759	1.045E-58	466	0.582	0.584	Q5TZ16.pdb.gz	Q5TZ16_DANRE Gamma-aminobutyric acid receptor subunit rho-1 precursor OS=Danio rerio OX=7955 GN=si:dkey-77b17.3 PE=3 SV=1
6	AFDB:O14764	0.686	0.708	4.250E-44	452	0.334	0.345	O14764.pdb.gz	GBRD_HUMAN Gamma-aminobutyric acid receptor subunit delta OS=Homo sapiens OX=9606 GN=GABRD PE=1 SV=2
7	AFDB:P63138	0.691	0.681	7.445E-44	474	0.353	0.348	P63138.pdb.gz	GBRB2_RAT Gamma-aminobutyric acid receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gabrb2 PE=1 SV=1
8	AFDB:P47870	0.710	0.650	2.042E-43	512	0.358	0.326	P47870.pdb.gz	GBRB2_HUMAN Gamma-aminobutyric acid receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=GABRB2 PE=1 SV=2
9	AFDB:A4FUK8	0.727	0.657	4.233E-43	519	0.370	0.333	A4FUK8.pdb.gz	A4FUK8_DANRE Gabrb2 protein OS=Danio rerio OX=7955 GN=gabrb2 PE=2 SV=1
10	AFDB:P28472	0.694	0.686	7.011E-43	473	0.370	0.366	P28472.pdb.gz	GBRB3_HUMAN Gamma-aminobutyric acid receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=GABRB3 PE=1 SV=1
11	PDB:6i53B	0.673	0.922	1.801E-38	338	0.334	0.462	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.648	0.861	2.924E-33	349	0.278	0.372	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.596	0.807	2.743E-31	338	0.281	0.388	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.538	0.786	1.690E-22	311	0.139	0.209	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.494	0.724	7.177E-19	311	0.118	0.177	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.472	0.735	1.242E-15	288	0.124	0.201	6zgdA.pdb.gz
17	PDB:4aq5E	0.525	0.647	9.850E-14	370	0.111	0.141	4aq5E.pdb.gz
18	PDB:4afhA	0.356	0.738	3.381E-13	213	0.079	0.174	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:2w8gC	0.362	0.735	2.406E-12	217	0.077	0.166	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
20	PDB:5lhdC	0.132	0.083	2.204E-4	905	0.045	0.023	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MPY1	0.0	974	467	1.000	1.000	GBRR3_HUMAN Gamma-aminobutyric acid receptor subunit rho-3 OS=Homo sapiens OX=9606 GN=GABRR3 PE=3 SV=2
2	G1SEE5	0.0	571	479	0.600	0.585	G1SEE5_RABIT GABA(C) receptor OS=Oryctolagus cuniculus OX=9986 GN=GABRR1 PE=3 SV=3
3	P24046	0.0	568	479	0.589	0.574	GBRR1_HUMAN Gamma-aminobutyric acid receptor subunit rho-1 OS=Homo sapiens OX=9606 GN=GABRR1 PE=2 SV=2
4	P28476	0.0	556	465	0.585	0.587	GBRR2_HUMAN Gamma-aminobutyric acid receptor subunit rho-2 OS=Homo sapiens OX=9606 GN=GABRR2 PE=2 SV=5
5	P47742	0.0	551	465	0.580	0.583	GBRR2_RAT Gamma-aminobutyric acid receptor subunit rho-2 OS=Rattus norvegicus OX=10116 GN=Gabrr2 PE=1 SV=3
6	P50572	0.0	572	480	0.593	0.577	GBRR1_RAT Gamma-aminobutyric acid receptor subunit rho-1 OS=Rattus norvegicus OX=10116 GN=Gabrr1 PE=1 SV=2
7	P50573	0.0	800	464	0.842	0.847	GBRR3_RAT Gamma-aminobutyric acid receptor subunit rho-3 OS=Rattus norvegicus OX=10116 GN=Gabrr3 PE=1 SV=1
8	P56475	0.0	570	480	0.591	0.575	GBRR1_MOUSE Gamma-aminobutyric acid receptor subunit rho-1 OS=Mus musculus OX=10090 GN=Gabrr1 PE=2 SV=2
9	P56476	0.0	556	465	0.585	0.587	GBRR2_MOUSE Gamma-aminobutyric acid receptor subunit rho-2 OS=Mus musculus OX=10090 GN=Gabrr2 PE=2 SV=4
10	Q5TZ16	0.0	538	466	0.589	0.590	Q5TZ16_DANRE Gamma-aminobutyric acid receptor subunit rho-1 precursor OS=Danio rerio OX=7955 GN=si:dkey-77b17.3 PE=3 SV=1
11	P63079	4.48e-105	322	473	0.373	0.368	GBRB3_RAT Gamma-aminobutyric acid receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Gabrb3 PE=1 SV=1
12	P63080	4.48e-105	322	473	0.373	0.368	GBRB3_MOUSE Gamma-aminobutyric acid receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Gabrb3 PE=1 SV=1
13	P28472	1.50e-104	321	473	0.370	0.366	GBRB3_HUMAN Gamma-aminobutyric acid receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=GABRB3 PE=1 SV=1
14	P18505	2.13e-102	315	474	0.379	0.373	GBRB1_HUMAN Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=GABRB1 PE=1 SV=2
15	P15431	4.30e-102	315	474	0.375	0.369	GBRB1_RAT Gamma-aminobutyric acid receptor subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Gabrb1 PE=1 SV=1
16	P50571	4.64e-102	315	474	0.375	0.369	GBRB1_MOUSE Gamma-aminobutyric acid receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Gabrb1 PE=1 SV=1
17	P63138	3.57e-99	307	474	0.355	0.350	GBRB2_RAT Gamma-aminobutyric acid receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gabrb2 PE=1 SV=1
18	A4FUK8	6.31e-98	305	519	0.300	0.270	A4FUK8_DANRE Gabrb2 protein OS=Danio rerio OX=7955 GN=gabrb2 PE=2 SV=1
19	Q9DDD9	5.55e-96	300	519	0.296	0.266	Q9DDD9_DANRE GABAA receptor betaZ2 subunit OS=Danio rerio OX=7955 GN=gabaabeta2 PE=2 SV=1
20	P47870	5.21e-95	298	512	0.289	0.264	GBRB2_HUMAN Gamma-aminobutyric acid receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=GABRB2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	2e-49	179.5	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	1.2e-29	115.6	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386029	0.805	Gamma-aminobutyric acid receptor subunit rho-2
2	9606.ENSP00000412673	0.805	Gamma-aminobutyric acid receptor subunit rho-1
3	9606.ENSP00000332646	0.755	Major facilitator superfamily domain-containing protein 10
4	9606.ENSP00000376615	0.633	5'-nucleotidase domain containing 3
5	9606.ENSP00000359353	0.606	Gamma-aminobutyric acid receptor subunit epsilon
6	9606.ENSP00000216294	0.603	snRNA-activating protein complex subunit 1
7	9606.ENSP00000337008	0.603	Zinc finger protein 644
8	9606.ENSP00000264318	0.598	Gamma-aminobutyric acid receptor subunit alpha-4
9	9606.ENSP00000469332	0.592	Gamma-aminobutyric acid receptor subunit theta
10	9606.ENSP00000274545	0.586	Gamma-aminobutyric acid receptor subunit alpha-6
11	9606.ENSP00000359337	0.584	Gamma-aminobutyric acid receptor subunit alpha-3
12	9606.ENSP00000421828	0.584	Gamma-aminobutyric acid receptor subunit alpha-2
13	9606.ENSP00000479113	0.584	Gamma-aminobutyric acid receptor subunit gamma-3
14	9606.ENSP00000328251	0.583	Ribosomal oxygenase 2
15	9606.ENSP00000410732	0.578	Gamma-aminobutyric acid receptor subunit gamma-2
16	9606.ENSP00000295452	0.574	Gamma-aminobutyric acid receptor subunit gamma-1
17	9606.ENSP00000335592	0.574	Gamma-aminobutyric acid receptor subunit alpha-5
18	9606.ENSP00000430100	0.568	Gamma-aminobutyric acid receptor subunit pi
19	9606.ENSP00000393097	0.567	Gamma-aminobutyric acid receptor subunit alpha-1
20	9606.ENSP00000367848	0.566	Gamma-aminobutyric acid receptor subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0005230	0.999	extracellular ligand-gated monoatomic ion channel activity
GO:0005515	0.997	protein binding
GO:0005254	0.995	chloride channel activity
GO:0019904	0.993	protein domain specific binding
GO:0030594	0.977	neurotransmitter receptor activity
GO:0016917	0.969	GABA receptor activity
GO:0022824	0.952	transmitter-gated monoatomic ion channel activity
GO:0099095	0.802	ligand-gated monoatomic anion channel activity
GO:0005231	0.715	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0098960	0.561	postsynaptic neurotransmitter receptor activity
GO:1904315	0.509	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0023052	0.851	signaling
GO:0065007	0.841	biological regulation
GO:0007154	0.810	cell communication
GO:0051179	0.732	localization
GO:0006810	0.706	transport
GO:0050794	0.689	regulation of cellular process
GO:0007267	0.639	cell-cell signaling
GO:0006811	0.605	monoatomic ion transport
GO:0006820	0.562	monoatomic anion transport
GO:0015698	0.550	inorganic anion transport
GO:0006821	0.542	chloride transport
GO:0050896	0.449	response to stimulus
GO:0032501	0.312	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.995	chloride(in) = chloride(out)

[back to server]