StarFunc result for job id A8MQ11

User Input

>input (134 residues)
MWGRRRKLRRLNDVTISTCHVSAKVGTRLVFDHDGKIIQKTPYPHPRGTTVSVKQLFSTL
PVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTPRSTPPHPCSLEDNVI
TVFSSVKNGPGSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54278	0.452	0.075	1.527E-7	862	0.433	0.067	P54278.pdb.gz	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
2	AFDB:P54279	0.454	0.076	4.802E-7	859	0.388	0.061	P54279.pdb.gz	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
3	AFDB:F1NQJ3	0.456	0.074	1.117E-6	869	0.396	0.061	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
4	AFDB:B1H246	0.451	0.076	2.303E-6	853	0.396	0.062	B1H246.pdb.gz	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
5	AFDB:G5EFG5	0.452	0.078	3.436E-4	805	0.201	0.034	G5EFG5.pdb.gz	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
6	AFDB:Q941I6	0.456	0.069	4.645E-4	923	0.216	0.031	Q941I6.pdb.gz	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
7	AFDB:Q6P7D0	0.439	0.069	1.295E-3	919	0.157	0.023	Q6P7D0.pdb.gz	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
8	AFDB:P54280	0.453	0.081	2.367E-3	794	0.201	0.034	P54280.pdb.gz	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
9	AFDB:Q8K119	0.437	0.069	2.367E-3	917	0.157	0.023	Q8K119.pdb.gz	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
10	AFDB:A0A669KB03	0.394	0.106	3.398E-3	512	0.127	0.033	A0A669KB03.pdb.gz	A0A669KB03_HUMAN MutL homolog 1 OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
11	PDB:7p8vA	0.364	0.155	7.911E-3	331	0.104	0.042	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:5tthA	0.272	0.059	2.949E-1	671	0.075	0.015	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
13	PDB:2iopA	0.294	0.081	6.859E-1	618	0.097	0.021	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
14	PDB:3j81k	0.142	0.066	6.859E-1	365	0.060	0.022	3j81k.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
15	PDB:7kclB	0.291	0.081	6.859E-1	614	0.090	0.020	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
16	PDB:1ri6A	0.198	0.092	7.285E-1	333	0.067	0.027	1ri6A.pdb.gz
17	PDB:3tkpA	0.143	0.100	8.219E-1	197	0.097	0.066	3tkpA.pdb.gz
18	PDB:5b8aH	0.139	0.108	9.273E-1	177	0.097	0.073	5b8aH.pdb.gz
19	PDB:2h0eB	0.184	0.210	9.849E-1	114	0.037	0.044	2h0eB.pdb.gz
20	PDB:3j79V	0.143	0.126	9.849E-1	155	0.172	0.148	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J167	8.09e-42	148	756	0.515	0.091	C9J167_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=3 SV=2
2	P54278	4.83e-33	124	862	0.433	0.067	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
3	A0A8I5ZND0	1.30e-29	113	461	0.396	0.115	A0A8I5ZND0_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
4	F1NQJ3	2.68e-29	113	869	0.396	0.061	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
5	B1H246	3.50e-29	112	853	0.396	0.062	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
6	A0A0G2JW47	3.62e-29	112	882	0.396	0.060	A0A0G2JW47_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
7	D4A360	3.83e-29	112	800	0.396	0.066	D4A360_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=2
8	P54279	4.02e-29	112	859	0.396	0.062	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
9	A0A2R8Y6S3	4.42e-21	89.7	727	0.306	0.056	A0A2R8Y6S3_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=1
10	Q941I6	6.12e-11	60.8	923	0.306	0.044	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
11	G5EFG5	3.08e-09	55.8	805	0.201	0.034	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
12	P54280	8.37e-07	48.9	794	0.201	0.034	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
13	P14242	6.50e-06	46.2	873	0.164	0.025	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
14	P54277	0.002	39.3	932	0.172	0.025	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
15	A0A8I6AGZ9	0.003	38.9	880	0.164	0.025	A0A8I6AGZ9_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=1
16	D4A651	0.003	38.9	919	0.164	0.024	D4A651_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=3
17	Q38D26	0.003	38.5	788	0.187	0.032	Q38D26_TRYB2 Mismatch repair protein PMS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4840 PE=3 SV=1
18	Q6P7D0	0.003	38.9	919	0.164	0.024	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
19	Q9BLY2	0.003	38.5	788	0.187	0.032	Q9BLY2_9TRYP Putative mismatch repair protein PMS1 OS=Trypanosoma brucei OX=5691 GN=PMS1 PE=3 SV=1
20	E9Q8A5	0.004	38.1	669	0.164	0.033	E9Q8A5_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07661 MORN_2	4.3e+02	12.6	MORN repeat variant

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000019297

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000015949	0.972	mutL homolog 1
2	9593.ENSGGOP00000022032	0.954	DNA mismatch repair protein
3	9593.ENSGGOP00000018924	0.949	MutS homolog 6
4	9593.ENSGGOP00000008668	0.914	BRCA1 interacting protein C-terminal helicase 1
5	9593.ENSGGOP00000001911	0.901	Nuclease required for the repair of DNA interstrand cross- links (ICL). Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions.
6	9593.ENSGGOP00000027966	0.876	Component of the post-replicative DNA mismatch repair system (MMR)
7	9593.ENSGGOP00000013234	0.862	Exonuclease 1
8	9593.ENSGGOP00000011057	0.787	DNA mismatch repair protein
9	9593.ENSGGOP00000001670	0.636	Proliferating cell nuclear antigen
10	9593.ENSGGOP00000017490	0.636	Proliferating cell nuclear antigen
11	9593.ENSGGOP00000018939	0.605	Polymerase (DNA directed), delta 1, catalytic subunit
12	9593.ENSGGOP00000009561	0.592	Cellular tumor antigen p53
13	9593.ENSGGOP00000013754	0.567	ERCC excision repair 5, endonuclease
14	9593.ENSGGOP00000014730	0.536	Replication protein A subunit
15	9593.ENSGGOP00000009612	0.535	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
16	9593.ENSGGOP00000012253	0.523	Flap endonuclease 1
17	9593.ENSGGOP00000027062	0.523	Flap endonuclease 1
18	9593.ENSGGOP00000017047	0.516	PMS1 homolog 1, mismatch repair system component
19	9593.ENSGGOP00000021616	0.512	F-box protein, helicase, 18
20	9593.ENSGGOP00000011864	0.508	GEN1 Holliday junction 5' flap endonuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.981	heterocyclic compound binding
GO:0097159	0.981	organic cyclic compound binding
GO:0003676	0.781	nucleic acid binding
GO:0003677	0.759	DNA binding
GO:0003824	0.715	catalytic activity
GO:0016787	0.547	hydrolase activity
GO:0003690	0.356	double-stranded DNA binding
GO:0030983	0.303	mismatched DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.837	response to stimulus
GO:0009987	0.559	cellular process
GO:0065007	0.546	biological regulation
GO:0032501	0.539	multicellular organismal process
GO:0050789	0.527	regulation of biological process
GO:0032502	0.444	developmental process
GO:0048856	0.411	anatomical structure development
GO:0050794	0.335	regulation of cellular process
GO:0051716	0.319	cellular response to stimulus
GO:0007275	0.305	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.985	cytoplasm
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0005634	0.530	nucleus
GO:0031981	0.399	nuclear lumen
GO:0005654	0.387	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.547	Hydrolases.

[back to server]