StarFunc result for job id A8MQ14

User Input

>input (1090 residues)
MNMEGLVMFQDLSIDFSQEEWECLDAAQKDLYRDVMMENYSSLVSLGLSIPKPDVISLLE
QGKEPWMVSRDVLGGWCRDSEFRCKTKDSCLPKEIYEVTSSQWVRMEKCHSLVGSSVRDD
WECKGQFQHQDINQERYLEKAIMTYETTPTFCLQTSLTLHHRIHPGEKLYKSTECMAFKY
GSELTQQQETHTGEKLYKCKECGKAFHHFSYLVKHQRIHTGEKPCACKEYGKAFISGSHL
IQHQKMYTDERPHECQESVKAFRPSAHLIQHWRIHTGDKPYECKECGKSFTSGSTLNQHQ
QIHTGEKPYHCKQCGKSFTVGSTLIRHQQIHTGEKPYDCKECGKSFASGSALIRHQRIHT
GEKPYDCKECGKSFTFHSALIRHQRIHTGEKPYDCKECGKSFTFRSGLIGHQAIHTGEKP
YDCKECGKSFTAGSTLIQHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPYCCK
ECGKSFTFRSTRNRHQRIHTGEKPYNCKECGKSFASGSALLQHQRIHTGEKPYHCKECGK
SFTFRSGLIGHQAVHTGEKPYDCKECGKSFTSRSALIQHQRIHTGEKPYHCKECGKSFTV
GSTLLQHQQIHTGEKPYDCKECGKAFRLRLRLTQHQQIHTGEKPYQCQECGKAFVSVSGL
TQHHRIHTGEKPYECPDCGKAFRQRTYLNQHRRIHTGEKPYECKECGKSFTFCSGLIQHQ
QNHTDEKPYDGKECGKSFTSHSTLIQHQQIHTGEKPYDCKECGKSFTSHSTLIQHQQIHT
GEKLYDCKECGKSFTSHSTLIQHQPLHTGEKPYHCKECGKSFTLRSALIQHRPVHTGEKR
YSCKECGKSFTSRSTLIEHQRIHTGEKPYHCKECGKSFAFRSAIIQHRRIHTGEKPYDCK
ECGKAFRRRSKLTQHQRIHTGEKPYRCHECGKAFVRFSGLTKHHSIHTGEKPYECKTCGK
SFRQRTHLTLHQRIHTGDRPYECKECGKSFTCGSELIRHQRTHTGEKPYDCKECGKAFRC
PSQLSQHKRIHTGEKTYQCPECGKAFFYASGLSRHQSVHTGEKPYECKTCGKAFKQLTQL
TRHQRIHDLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	0.362	0.341	8.984E-100	1191	0.530	0.485	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:Q14587	0.421	0.476	2.003E-83	947	0.414	0.476	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
3	AFDB:A0A1B0GR71	0.394	0.435	2.031E-77	966	0.386	0.436	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
4	AFDB:Q5TYW1	0.263	0.269	2.675E-73	1059	0.441	0.454	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
5	AFDB:Q9UII5	0.228	0.294	4.577E-71	783	0.358	0.498	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
6	AFDB:Q96JF6	0.242	0.318	1.275E-66	807	0.361	0.488	Q96JF6.pdb.gz	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
7	AFDB:P51523	0.293	0.409	1.889E-65	738	0.339	0.501	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	AFDB:Q62788	0.268	0.375	1.519E-62	744	0.310	0.454	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
9	AFDB:Q9Y3M9	0.346	0.464	2.265E-62	751	0.277	0.402	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
10	AFDB:Q6ZR52	0.308	0.469	3.213E-62	646	0.316	0.533	Q6ZR52.pdb.gz	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
11	PDB:3w5kB	0.053	0.281	1.039E-3	110	0.039	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7cunA	0.061	0.077	1.185	730	0.053	0.079	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
13	PDB:4kblA	0.043	0.078	1.376	395	0.058	0.159	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:5ijnC	0.058	0.085	1.376	636	0.065	0.112	5ijnC.pdb.gz
15	PDB:6hivCv	0.044	0.045	1.447	1059	0.071	0.073	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7o4i1	0.052	0.085	1.447	522	0.055	0.115	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:5oqj2	0.048	0.091	1.598	395	0.035	0.096	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:6lsr0	0.033	0.109	1.598	190	0.024	0.137	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
19	PDB:5c8dE	0.054	0.117	1.680	280	0.025	0.096	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
20	PDB:7wooZ	0.095	0.117	1.680	746	0.064	0.094	7wooZ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	553	609	0.253	0.453	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A0A1B0GR71	674	966	0.353	0.399	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	A0A8I6G8Y2	548	723	0.260	0.391	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
4	A6NNF4	551	616	0.272	0.481	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	A8K8Y5	560	707	0.260	0.400	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	F8WEC7	568	859	0.325	0.412	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
7	G3V9G6	549	740	0.260	0.382	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
8	K7EK80	544	552	0.264	0.522	K7EK80_HUMAN Zinc finger protein 540 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF540 PE=4 SV=1
9	O75290	565	641	0.250	0.426	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
10	O75437	549	659	0.272	0.451	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
11	O94892	593	652	0.302	0.505	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
12	P15620	551	580	0.256	0.481	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
13	P17014	577	697	0.305	0.476	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
14	P17020	551	682	0.254	0.406	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
15	P17021	546	662	0.262	0.432	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
16	P17027	578	643	0.260	0.440	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
17	P17038	678	809	0.321	0.433	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
18	P17097	560	686	0.290	0.461	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
19	P35789	546	620	0.244	0.429	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
20	P51523	609	738	0.283	0.417	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19414 Astro_p19	1.1e+02	13.7	Astrovirus p19 protein
2	PF12552 DUF3741	3e-07	41.6	Protein of unknown function (DUF3741)
3	PF19148 DUF5830	0.23	22.8	Family of unknown function (DUF5830)
4	PF07754 HVO_2753_ZBP	9.7	17.4	Small zinc finger protein HVO_2753-like, Zn-binding pocket
5	PF01352 KRAB	4.9e-19	79.0	KRAB box
6	PF15967 Nucleoporin_FG2	1.4e+02	12.4	Nucleoporin FG repeated region
7	PF01197 Ribosomal_L31	15	17.2	Ribosomal protein L31
8	PF01286 XPA_N	1.5e-11	55.4	XPA protein N-terminal
9	PF00096 zf-C2H2	2.9e-142	466.9	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	2.7e-20	83.1	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	1.8e-75	254.0	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	4.4e-51	181.2	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	1.9e-19	80.7	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	7.3e-236	764.7	Zinc-finger double domain
15	PF12874 zf-met	2.2e-27	105.9	Zinc-finger of C2H2 type
16	PF13451 zf-trcl	5.9e-09	47.0	Probable zinc-ribbon domain
17	PF18439 zf_UBZ	9.7e-14	62.0	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	4.5e-06	38.7	zinc-ribbon family
19	PF09723 Zn-ribbon_8	1.1e-34	129.6	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	0.47	21.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246421	0.663	Solute carrier family 35 member E2
2	9606.ENSP00000481694	0.635	Solute carrier family 35 member E2B
3	9606.ENSP00000366934	0.627	Polynucleotide 5'-hydroxyl-kinase NOL9
4	9606.ENSP00000338573	0.626	Guanine nucleotide-binding protein-like 3-like protein
5	9606.ENSP00000348380	0.621	Cytochrome P450 family 20 subfamily A member 1
6	9606.ENSP00000371073	0.614	PI-PLC X domain-containing protein 1
7	9606.ENSP00000262031	0.538	RNA-binding motif, single-stranded-interacting protein 2
8	9606.ENSP00000477341	0.535	Protein phosphatase 1K, mitochondrial
9	9606.ENSP00000385432	0.517	GTP-binding protein SAR1b
10	9606.ENSP00000361700	0.512	Glycine receptor subunit alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.925	regulation of cellular process
GO:0080090	0.904	regulation of primary metabolic process
GO:0010556	0.881	regulation of macromolecule biosynthetic process
GO:0031326	0.881	regulation of cellular biosynthetic process
GO:0048519	0.872	negative regulation of biological process
GO:0019219	0.868	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.861	negative regulation of cellular process
GO:0010605	0.840	negative regulation of macromolecule metabolic process
GO:0051172	0.831	negative regulation of nitrogen compound metabolic process
GO:0031324	0.831	negative regulation of cellular metabolic process
GO:0010558	0.703	negative regulation of macromolecule biosynthetic process
GO:0045934	0.703	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.702	negative regulation of cellular biosynthetic process
GO:0009987	0.627	cellular process
GO:0006355	0.540	regulation of DNA-templated transcription
GO:0045892	0.501	negative regulation of DNA-templated transcription
GO:0008152	0.350	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.743	cytoplasm
GO:0016020	0.638	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]