StarFunc result for job id A8MQB3

User Input

>input (221 residues)
MGEKSRRKGPAPRHADGKLGRTCDHPYAPWSFTPSSRAPTAWVRPPCPVWASRLQEHSPE
PRRARAPPTRRAQAALYAPALRLRDHLDRFSILMTSCTSWLQAPQAPGLCRDEQSSRISV
PQLSGAPILLPDLEGTKLSNFQESSPLPHKHERKDKRSTPEEEGRSAPEKIIQSLKLCPG
GHRPASLSSGCPAGCRLSFNLPPSMLLSVQKCCMPSSLKTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EB06	0.118	0.043	3.022E-1	698	0.190	0.060	G5EB06.pdb.gz	G5EB06_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02919 PE=4 SV=1
2	AFDB:Q9U3V5	0.081	0.023	4.925	1024	0.199	0.043	Q9U3V5.pdb.gz	TIPT_DROME Protein tiptop OS=Drosophila melanogaster OX=7227 GN=tio PE=2 SV=2
3	AFDB:P19622	0.079	0.060	5.263	333	0.163	0.108	P19622.pdb.gz	HME2_HUMAN Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3
4	AFDB:Q92754	0.107	0.064	5.625	450	0.186	0.091	Q92754.pdb.gz	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
5	AFDB:A0A0B6VLS4	0.102	0.028	6.424	1152	0.158	0.030	A0A0B6VLS4.pdb.gz
6	AFDB:G5EB07	0.093	0.052	6.866	461	0.222	0.106	G5EB07.pdb.gz	G5EB07_EMENI GATA-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nsdD PE=4 SV=1
7	AFDB:P83949	0.087	0.056	6.866	389	0.140	0.080	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
8	AFDB:Q9M155	0.125	0.042	7.337	714	0.145	0.045	Q9M155.pdb.gz	Q9M155_ARATH AT4G01090 protein OS=Arabidopsis thaliana OX=3702 GN=At4g01090 PE=1 SV=1
9	AFDB:E1JHY2	0.111	0.052	7.841	579	0.145	0.055	E1JHY2.pdb.gz	E1JHY2_DROME Spermitin, isoform F OS=Drosophila melanogaster OX=7227 GN=Sprn PE=4 SV=1
10	PDB:6ff4C	0.081	0.064	7.904	286	0.104	0.080	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	AFDB:Q7TP39	0.110	0.036	8.380	866	0.231	0.059	Q7TP39.pdb.gz	Q7TP39_RAT Ab2-427 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33744	1.8	32.0	862	0.063	0.016	ADHE_CLOAB Aldehyde-alcohol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=adhE PE=1 SV=3
2	P24583	5.5	30.4	1151	0.063	0.012	KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKC1 PE=1 SV=3
3	Q8I8A4	8.0	29.6	249	0.072	0.064	Q8I8A4_LEIMA N-acetylglucosaminylphosphatidylinositol deacetylase OS=Leishmania major OX=5664 GN=GPI12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17699 DUF5545	4.7e-126	430.3	Family of unknown function (DUF5545)
2	PF05509 TraY	1.8e+02	13.6	TraY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384286

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000475146	0.666	Uncharacterized protein C17orf50
2	9606.ENSP00000328061	0.661	Uncharacterized protein SPEM2
3	9606.ENSP00000479396	0.635	Uncharacterized protein C17orf98
4	9606.ENSP00000415662	0.601	Uncharacterized protein C17orf105
5	9606.ENSP00000298912	0.557	Calmin
6	9606.ENSP00000329056	0.556	Olfactory receptor 4C46
7	9606.ENSP00000379566	0.517	Coiled-coil alpha-helical rod protein 1
8	9606.ENSP00000350295	0.507	Zinc finger protein 816
9	9606.ENSP00000369666	0.503	F-box/LRR-repeat protein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.515	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.954	biological regulation
GO:0050789	0.898	regulation of biological process
GO:0050794	0.806	regulation of cellular process
GO:0019222	0.414	regulation of metabolic process
GO:0032501	0.408	multicellular organismal process
GO:0032502	0.376	developmental process
GO:0048856	0.364	anatomical structure development
GO:0051171	0.356	regulation of nitrogen compound metabolic process
GO:0031323	0.354	regulation of cellular metabolic process
GO:0080090	0.331	regulation of primary metabolic process
GO:0060255	0.326	regulation of macromolecule metabolic process
GO:0071704	0.323	organic substance metabolic process
GO:0048518	0.322	positive regulation of biological process
GO:0006807	0.321	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.949	intracellular organelle lumen
GO:0005737	0.881	cytoplasm
GO:0031981	0.838	nuclear lumen
GO:0005654	0.826	nucleoplasm
GO:0043232	0.570	intracellular non-membrane-bounded organelle
GO:0016020	0.444	membrane
GO:0016604	0.427	nuclear body
GO:0005886	0.319	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]