StarFunc result for job id A8MT69

User Input

>input (81 residues)
MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAE
DALRVDVDQLEKVLPQLLLDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MT69	1.000	1.000	1.432E-12	81	1.000	1.000	A8MT69.pdb.gz	CENPX_HUMAN Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1
2	PDB:4draH	0.911	0.970	1.028E-10	76	0.938	1.000	4draH.pdb.gz
3	AFDB:P0DJH7	0.923	0.935	2.747E-9	80	0.642	0.650	P0DJH7.pdb.gz	CENPX_CHICK Centromere protein X OS=Gallus gallus OX=9031 GN=CENPX PE=1 SV=1
4	PDB:3b0bC	0.894	0.965	1.255E-8	75	0.642	0.693	3b0bC.pdb.gz
5	AFDB:Q8L7N3	0.786	0.628	1.074E-3	104	0.370	0.288	Q8L7N3.pdb.gz	CENPX_ARATH Protein MHF2 homolog OS=Arabidopsis thaliana OX=3702 GN=MHF2 PE=3 SV=1
6	AFDB:Q3E829	0.809	0.819	4.396E-3	80	0.185	0.188	Q3E829.pdb.gz	CENPX_YEAST Inner kinetochore subunit MHF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MHF2 PE=1 SV=1
7	AFDB:Q9FGJ3	0.705	0.316	4.687E-3	190	0.210	0.089	Q9FGJ3.pdb.gz	NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1
8	PDB:3v9rB	0.698	0.766	4.907E-3	73	0.173	0.192	3v9rB.pdb.gz
9	AFDB:P13434	0.775	0.450	4.997E-3	144	0.198	0.111	P13434.pdb.gz	HAP3_YEAST Transcriptional activator HAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP3 PE=1 SV=1
10	AFDB:Q5B5Z6	0.774	0.300	4.997E-3	219	0.173	0.064	Q5B5Z6.pdb.gz	Q5B5Z6_EMENI Transcription factor HapC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04034 PE=1 SV=1
11	AFDB:P49592	0.818	0.434	5.328E-3	159	0.148	0.075	P49592.pdb.gz	NC2B_ARATH Protein Dr1 homolog OS=Arabidopsis thaliana OX=3702 GN=DR1 PE=1 SV=1
12	AFDB:Q944I5	0.818	0.424	5.328E-3	163	0.148	0.074	Q944I5.pdb.gz	Q944I5_ARATH AT5g08190/T22D6_130 OS=Arabidopsis thaliana OX=3702 GN=NF-YB12 PE=1 SV=1
13	AFDB:G2TRL2	0.743	0.816	6.884E-3	73	0.148	0.164	G2TRL2.pdb.gz	CENPW_SCHPO Inner kinetochore subunit wip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wip1 PE=2 SV=1
14	PDB:5y26B	0.724	0.643	1.203E-2	92	0.160	0.141	5y26B.pdb.gz
15	PDB:5y27A	0.785	0.657	1.884E-2	98	0.136	0.112	5y27A.pdb.gz
16	PDB:1jfiB	0.755	0.467	4.064E-2	135	0.099	0.059	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
17	PDB:7edxk	0.747	0.630	4.064E-2	98	0.185	0.153	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:6wjv4	0.666	0.523	5.968E-2	107	0.185	0.140	6wjv4.pdb.gz
19	PDB:2rvqC	0.582	0.390	6.784E-2	133	0.173	0.105	2rvqC.pdb.gz
20	PDB:6xwtA	0.632	0.683	7.711E-2	74	0.111	0.122	6xwtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MT69	2.77e-51	156	81	1.000	1.000	CENPX_HUMAN Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1
2	P0DJH7	9.58e-21	79.7	80	0.642	0.650	CENPX_CHICK Centromere protein X OS=Gallus gallus OX=9031 GN=CENPX PE=1 SV=1
3	Q8L7N3	7.68e-09	50.1	104	0.321	0.250	CENPX_ARATH Protein MHF2 homolog OS=Arabidopsis thaliana OX=3702 GN=MHF2 PE=3 SV=1
4	P42695	1.5	29.3	1498	0.210	0.011	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
5	A0A087X2G1	1.7	28.9	636	0.198	0.025	A0A087X2G1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2
6	F1T0B3	1.7	28.9	659	0.198	0.024	F1T0B3_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=1
7	Q91VR5	1.8	28.9	740	0.198	0.022	DDX1_MOUSE ATP-dependent RNA helicase DDX1 OS=Mus musculus OX=10090 GN=Ddx1 PE=1 SV=1
8	A3RJH1	2.0	28.9	740	0.198	0.022	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
9	Q92499	2.0	28.9	740	0.198	0.022	DDX1_HUMAN ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2
10	O64257	5.5	27.3	232	0.222	0.078	VG65_BPMD2 Gene 65 protein OS=Mycobacterium phage D29 OX=28369 GN=65 PE=4 SV=1
11	A0A8I6A4V6	6.2	27.3	3699	0.173	0.004	A0A8I6A4V6_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=1
12	F1MAN8	6.2	27.3	3713	0.173	0.004	F1MAN8_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=2
13	Q9SF37	7.7	26.9	801	0.210	0.021	MCM8_ARATH Probable DNA helicase MCM8 OS=Arabidopsis thaliana OX=3702 GN=MCM8 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	1.2e+02	14.4	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF09415 CENP-X	4.5e-21	86.3	CENP-S associating Centromere protein X

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267430	0.999	Fanconi anemia group M protein
2	9606.ENSP00000308583	0.999	Centromere protein S
3	9606.ENSP00000367910	0.999	Fanconi anemia group G protein
4	9606.ENSP00000373952	0.999	Fanconi anemia group A protein
5	9606.ENSP00000385021	0.999	E3 ubiquitin-protein ligase FANCL
6	9606.ENSP00000466121	0.999	Fanconi anemia core complex-associated protein 24
7	9606.ENSP00000333283	0.997	Fanconi anemia core complex-associated protein 100
8	9606.ENSP00000229769	0.996	Fanconi anemia group E protein
9	9606.ENSP00000289081	0.996	Fanconi anemia group C protein
10	9606.ENSP00000330875	0.996	Fanconi anemia group F protein
11	9606.ENSP00000370214	0.974	Centromere protein O
12	9606.ENSP00000254719	0.969	Replication protein A 70 kDa DNA-binding subunit
13	9606.ENSP00000383710	0.967	Fanconi anemia core complex-associated protein 20
14	9606.ENSP00000363017	0.965	Replication protein A 32 kDa subunit
15	9606.ENSP00000381378	0.964	Fanconi anemia group B protein
16	9606.ENSP00000337289	0.956	Centromere protein Q
17	9606.ENSP00000357308	0.955	Constitutive centromere associated network
18	9606.ENSP00000457810	0.952	Centromere protein T
19	9606.ENSP00000281453	0.951	Centromere protein U
20	9606.ENSP00000307491	0.945	WD repeat-containing protein 48

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.993	DNA binding
GO:0003690	0.968	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006310	0.992	DNA recombination
GO:0006281	0.992	DNA repair
GO:0006261	0.988	DNA-templated DNA replication
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051173	0.981	positive regulation of nitrogen compound metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0007127	0.976	meiosis I
GO:0031297	0.976	replication fork processing
GO:0031398	0.968	positive regulation of protein ubiquitination
GO:0035825	0.965	homologous recombination
GO:0007059	0.964	chromosome segregation
GO:0007131	0.963	reciprocal meiotic recombination
GO:0036297	0.952	interstrand cross-link repair
GO:0098813	0.810	nuclear chromosome segregation
GO:0045132	0.665	meiotic chromosome segregation
GO:0050794	0.393	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0000785	0.998	chromatin
GO:0005737	0.528	cytoplasm
GO:0005829	0.373	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]