StarFunc result for job id A8MTJ6

User Input

>input (420 residues)
MALYCGDNFGVYSQPGLPPPAATAAAPGAPPAARAPYGLADYAAPPAAAANPYLWLNGPG
VGGPPSAAAAAAAAYLGAPPPPPPPGAAAGPFLQPPPAAGTFGCSQRPFAQPAPAAPASP
AAPAGPGELGWLSMASREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFP
FYQRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR
RSEASNGSTVAAGTSKSEEGLSSGLGSGVGGKPEEESPSTLLRPSHSPEPPEGTKSTASS
PGGPMLTSTPCLNTFFSSLSSLSVSSSVSTQRALPGSRHLGIQGAQLPSSGVFSPTSISE
ASADTLQLSNSTSNSTGQRSSYYSPFPASTSGGQSSPFSSPFHNFSMVNSLIYPREGSEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91765	0.234	0.228	3.262E-16	434	0.252	0.244	Q91765.pdb.gz	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
2	AFDB:B3DGF9	0.254	0.243	3.474E-16	441	0.252	0.240	B3DGF9.pdb.gz
3	AFDB:F1R8Z9	0.245	0.234	1.681E-15	442	0.260	0.247	F1R8Z9.pdb.gz	FXJ1B_DANRE Forkhead box protein J1-B OS=Danio rerio OX=7955 GN=foxj1b PE=2 SV=1
4	AFDB:Q9QY14	0.225	0.326	4.612E-15	288	0.255	0.372	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
5	AFDB:Q01167	0.232	0.152	9.830E-15	660	0.238	0.152	Q01167.pdb.gz	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
6	AFDB:Q9YHC5	0.203	0.195	1.628E-14	436	0.257	0.248	Q9YHC5.pdb.gz	FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis OX=8355 GN=foxg1 PE=2 SV=1
7	AFDB:P34683	0.240	0.421	2.532E-14	237	0.179	0.316	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
8	AFDB:O73779	0.237	0.334	7.398E-14	297	0.217	0.306	O73779.pdb.gz	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
9	AFDB:O73843	0.250	0.320	1.014E-13	324	0.226	0.293	O73843.pdb.gz	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
10	AFDB:O93529	0.239	0.314	1.577E-13	319	0.202	0.266	O93529.pdb.gz	FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis OX=8355 GN=foxb1 PE=2 SV=1
11	PDB:2hdcA	0.196	0.684	2.697E-9	97	0.150	0.649	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:2fe3B	0.135	0.346	5.912E-2	143	0.026	0.077	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
13	PDB:5hs7A	0.144	0.473	7.608E-2	102	0.019	0.078	5hs7A.pdb.gz
14	PDB:6zmiCE	0.137	0.667	7.608E-2	72	0.031	0.181	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:2qbyB	0.152	0.171	8.103E-2	368	0.033	0.038	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:2nyxB	0.149	0.358	8.631E-2	147	0.026	0.075	2nyxB.pdb.gz
17	PDB:5k1yD	0.135	0.518	8.631E-2	92	0.029	0.130	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
18	PDB:4etsB	0.141	0.352	1.043E-1	149	0.021	0.060	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
19	PDB:7dn3O	0.137	0.130	1.043E-1	443	0.040	0.038	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
20	PDB:7k5yU	0.139	0.629	1.043E-1	75	0.036	0.200	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NY62	2.24e-100	306	383	0.498	0.546	Q6NY62_DANRE Forkhead box I2 OS=Danio rerio OX=7955 GN=foxi2 PE=2 SV=2
2	Q804B2	5.46e-89	276	377	0.426	0.475	Q804B2_DANRE Forkhead box protein I2 OS=Danio rerio OX=7955 GN=cb724 PE=2 SV=1
3	Q7T1C0	1.79e-83	262	383	0.426	0.467	FXI3B_DANRE Forkhead box protein I3-B OS=Danio rerio OX=7955 GN=foxi3b PE=2 SV=1
4	E0XEN6	3.28e-83	261	378	0.412	0.458	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
5	Q12951	3.28e-83	261	378	0.412	0.458	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3
6	Q7ZYQ0	1.17e-81	257	373	0.405	0.456	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
7	Q91905	3.00e-81	256	367	0.379	0.433	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
8	Q91904	1.88e-79	251	370	0.412	0.468	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
9	Q922I5	2.14e-77	246	372	0.390	0.441	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
10	A3KNJ3	3.87e-74	237	353	0.395	0.470	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
11	Q63248	1.67e-57	186	101	0.193	0.802	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
12	Q64731	4.48e-45	161	336	0.179	0.223	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
13	Q12952	3.35e-44	159	345	0.155	0.188	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
14	Q7SY22	1.38e-43	157	363	0.155	0.179	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
15	Q61850	6.30e-42	156	494	0.152	0.130	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
16	Q63246	6.91e-42	156	494	0.152	0.130	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
17	Q99958	8.11e-42	156	501	0.152	0.128	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
18	Q9PVY9	1.33e-41	155	465	0.226	0.204	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1
19	Q9PVZ3	7.14e-41	153	492	0.150	0.128	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
20	Q61572	1.55e-40	153	553	0.152	0.116	FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus OX=10090 GN=Foxc1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	3e-35	131.5	Forkhead domain
2	PF13391 HNH_2	6.6e+02	11.9	HNH endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478384

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321805	0.614	GTP-binding protein Rit2
2	9606.ENSP00000265354	0.545	Serum response factor
3	9606.ENSP00000372056	0.529	Iroquois-class homeodomain protein IRX-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0001216	0.999	DNA-binding transcription activator activity
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.993	transcription cis-regulatory region binding
GO:0005515	0.974	protein binding
GO:0000977	0.750	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.718	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.686	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.400	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.975	regulation of cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0032502	0.947	developmental process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0048518	0.929	positive regulation of biological process
GO:0080090	0.922	regulation of primary metabolic process
GO:0051171	0.918	regulation of nitrogen compound metabolic process
GO:0010468	0.918	regulation of gene expression
GO:0031323	0.905	regulation of cellular metabolic process
GO:0048856	0.876	anatomical structure development
GO:0009987	0.871	cellular process
GO:0019219	0.818	regulation of nucleobase-containing compound metabolic process
GO:1903508	0.805	positive regulation of nucleic acid-templated transcription
GO:0045893	0.788	positive regulation of DNA-templated transcription
GO:0032501	0.744	multicellular organismal process
GO:0006357	0.731	regulation of transcription by RNA polymerase II
GO:0007275	0.560	multicellular organism development
GO:0048731	0.460	system development
GO:0048513	0.440	animal organ development
GO:0048519	0.408	negative regulation of biological process
GO:0048523	0.346	negative regulation of cellular process
GO:0045944	0.326	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005654	0.941	nucleoplasm
GO:0043228	0.747	non-membrane-bounded organelle
GO:0043232	0.725	intracellular non-membrane-bounded organelle
GO:0005737	0.625	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]