StarFunc result for job id A8MUN3

User Input

>input (132 residues)
MSFEYRHYKREAKICTCRGGWAHVLLCIGVSQGACAEHLPHRPAVEKDVPGAGEVLFMCS
WRIFPVASASPSSSISGLAGHSVFLVPGLAAHPGSHSDQPPGVPSRRKSRLERWSPSVSR
STSPPTEAPFCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EB62	0.245	0.036	2.574E-1	1280	0.189	0.020	G5EB62.pdb.gz	G5EB62_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=fphA PE=4 SV=1
2	AFDB:P0AGE0	0.169	0.128	2.904E-1	178	0.136	0.101	P0AGE0.pdb.gz	SSB_ECOLI Single-stranded DNA-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=ssb PE=1 SV=2
3	PDB:7vbaN	0.150	0.137	3.091E-1	151	0.152	0.132	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
4	AFDB:P28300	0.196	0.082	3.928E-1	417	0.174	0.055	P28300.pdb.gz	LYOX_HUMAN Protein-lysine 6-oxidase OS=Homo sapiens OX=9606 GN=LOX PE=1 SV=2
5	AFDB:A0A1S3PBB7	0.147	0.073	4.173E-1	375	0.152	0.053	A0A1S3PBB7.pdb.gz	KNG_SALSA Kininogen OS=Salmo salar OX=8030 GN=LOC106584303 PE=1 SV=1
6	AFDB:A0A2U3TZL8	0.214	0.048	4.432E-1	810	0.144	0.023	A0A2U3TZL8.pdb.gz	A0A2U3TZL8_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=1
7	AFDB:P38830	0.215	0.057	4.708E-1	627	0.189	0.040	P38830.pdb.gz	NDT80_YEAST Meiosis-specific transcription factor NDT80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NDT80 PE=1 SV=4
8	AFDB:P97857	0.160	0.038	5.002E-1	968	0.106	0.014	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
9	AFDB:Q13103	0.134	0.119	5.313E-1	211	0.152	0.095	Q13103.pdb.gz	SPP24_HUMAN Secreted phosphoprotein 24 OS=Homo sapiens OX=9606 GN=SPP2 PE=1 SV=1
10	AFDB:Q80VR2	0.179	0.081	5.313E-1	395	0.106	0.035	Q80VR2.pdb.gz	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
11	AFDB:Q57XU2	0.179	0.043	5.644E-1	912	0.136	0.020	Q57XU2.pdb.gz	Q57XU2_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.100 PE=4 SV=1
12	PDB:1k6zA	0.162	0.171	7.647E-1	122	0.068	0.074	1k6zA.pdb.gz
13	PDB:7dskA	0.124	0.051	1.167	471	0.121	0.034	7dskA.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
14	PDB:7pdzE	0.223	0.116	1.167	272	0.083	0.040	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.
15	PDB:4akrB	0.215	0.121	1.486	245	0.053	0.029	4akrB.pdb.gz
16	PDB:7mscq	0.249	0.335	1.677	95	0.038	0.053	7mscq.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
17	PDB:2cczA	0.176	0.189	1.892	121	0.038	0.041	2cczA.pdb.gz	Complexed Crystal Structure of Replication Restart Primsome Protein Prib Reveals a Novel Single-Stranded DNA-Binding Mode.
18	PDB:7d4iRJ	0.134	0.033	2.010	738	0.144	0.026	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
19	PDB:1k3eB	0.176	0.165	2.135	144	0.068	0.062	1k3eB.pdb.gz
20	PDB:2q2eB	0.162	0.048	2.135	581	0.083	0.019	2q2eB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62598	0.006	37.7	596	0.197	0.044	ARR12_ARATH Two-component response regulator ARR12 OS=Arabidopsis thaliana OX=3702 GN=ARR12 PE=2 SV=2
2	O42357	0.65	31.6	327	0.144	0.058	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
3	O97267	3.8	29.6	2114	0.174	0.011	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
4	F4K790	4.5	29.3	1051	0.152	0.019	F4K790_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2656 PE=1 SV=1
5	Q20357	6.4	28.9	853	0.114	0.018	Q20357_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-10 PE=1 SV=3
6	Q51338	7.7	28.9	2448	0.121	0.007	Q51338_PSEAI Pyoverdine synthetase D OS=Pseudomonas aeruginosa OX=287 GN=pvdD PE=4 SV=1
7	Q9I182	7.7	28.9	2448	0.121	0.007	Q9I182_PSEAE Pyoverdine synthetase D OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdD PE=4 SV=1
8	O14039	7.8	28.5	460	0.167	0.048	RCM1_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase rcm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcm1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 3702.AT2G25180.1

Rank	PPI partner	STRING score	Description
1	3702.AT1G03430.1	0.931	Encodes AHP5, one of the six Arabidopsis thaliana histidine phosphotransfer proteins (AHPs). AHPs function as redundant positive regulators of cytokinin signaling. Members of the AHP gene family include: AT3G21510 (AHP1), AT3G29350 (AHP2), AT5G39340 (AHP3), AT3G16360 (AHP4), AT1G03430 (AHP5) and AT1G80100 (AHP6)
2	3702.AT5G39340.1	0.928	Encodes AHP3, one of the six Arabidopsis thaliana histidine phosphotransfer proteins (AHPs) involved in Histidine (His)-to-Aspartate (Asp) phosphorelay signal transduction. AHPs function as redundant positive regulators of cytokinin signaling. Members of the AHP gene family include: AT3G21510 (AHP1), AT3G29350 (AHP2), AT5G39340 (AHP3), AT3G16360 (AHP4), AT1G03430 (AHP5) and AT1G80100 (AHP6)
3	3702.AT2G01830.2	0.900	CHASE domain containing histidine kinase protein
4	3702.AT1G80100.1	0.883	Pseudo histidine-containing phosphotransfer protein 6
5	3702.AT1G27320.1	0.874	Histidine kinase 3
6	3702.AT4G23750.1	0.867	Ethylene-responsive transcription factor CRF2
7	3702.AT5G35750.1	0.849	Histidine kinase 2
8	3702.AT3G16360.2	0.845	Encodes AHP4, a histidine-containing phosphotransmitter involved in Histidine (His)-to-Aspartate (Asp) phosphorelay signal transduction. AHP4 is one of the six Arabidopsis thaliana histidine phosphotransfer proteins (AHPs). AHPs function as redundant positive regulators of cytokinin signaling. Members of the AHP gene family include: AT3G21510 (AHP1), AT3G29350 (AHP2), AT5G39340 (AHP3), AT3G16360 (AHP4), AT1G03430 (AHP5) and AT1G80100 (AHP6)
9	3702.AT3G29350.1	0.841	Encodes AHP2, one of the six Arabidopsis thaliana histidine phosphotransfer proteins (AHPs). AHPs function in His-to-Asp phosphorelay signal transduction and as redundant positive regulators of cytokinin signaling. Members of the AHP gene family include: AT3G21510 (AHP1), AT3G29350 (AHP2), AT5G39340 (AHP3), AT3G16360 (AHP4), AT1G03430 (AHP5) and AT1G80100 (AHP6)
10	3702.AT4G04402.1	0.810	Two-component phosphorelay mediator, putative
11	3702.AT4G11140.1	0.805	Ethylene-responsive transcription factor CRF1
12	3702.AT3G21510.1	0.753	Encodes AHP1, one of the six Arabidopsis thaliana histidine phosphotransfer proteins (AHPs). AHPs function as redundant positive regulators of cytokinin signaling. Members of the AHP gene family include: AT3G21510 (AHP1), AT3G29350 (AHP2), AT5G39340 (AHP3), AT3G16360 (AHP4), AT1G03430 (AHP5) and AT1G80100 (AHP6)
13	3702.AT1G04240.1	0.721	AUX/IAA transcriptional regulator family protein
14	3702.AT3G04280.1	0.695	Encodes an atypical subtype of the ARR (Arabidopsis response regulator) protein family. ARR22 is more similar to the receiver domains of hybrid kinases than other response regulators. It acts as a phosphohistidine phosphatase when tested with phospho-AHP5 in vitro suggesting that it might be involved in a two-component phosphorelay. Expression of ARR22 transcripts appears to be localized to the chalaza and to be induced by wounding. Ectopic expression of ARR in other parts of the plant leads to reduced cytokinin-related responses and impaired root, shoot, and flower development. Overex [...]
15	3702.AT5G19040.1	0.637	Adenylate isopentenyltransferase 5, chloroplastic
16	3702.AT2G17950.1	0.635	Homeodomain-like superfamily protein
17	3702.AT2G17820.1	0.625	Histidine kinase 1
18	3702.AT5G26594.1	0.619	Response regulator 24
19	3702.AT3G59940.1	0.612	Galactose oxidase/kelch repeat superfamily protein
20	3702.AT1G70940.1	0.611	Auxin efflux carrier family protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.469	biological regulation
GO:0050789	0.464	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.980	intracellular anatomical structure
GO:0005737	0.921	cytoplasm
GO:0043226	0.452	organelle
GO:0043229	0.421	intracellular organelle
GO:0043227	0.415	membrane-bounded organelle
GO:0043231	0.368	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]