StarFunc result for job id A8MUU1

User Input

>input (101 residues)
MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGAL
VQHQEWDGKESTITRKLKDGKLVVERVMNHVACTRIYEKAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55052	0.988	0.740	7.198E-15	135	0.842	0.630	P55052.pdb.gz	FABP5_BOVIN Fatty acid-binding protein 5 OS=Bos taurus OX=9913 GN=FABP5 PE=1 SV=4
2	AFDB:P55053	0.992	0.744	2.144E-14	135	0.792	0.593	P55053.pdb.gz	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
3	PDB:5ur9F	0.927	0.687	2.935E-14	138	0.911	0.667	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
4	PDB:4azqA	0.987	0.735	3.458E-14	136	0.772	0.574	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
5	AFDB:A0A0K0MJN3	0.964	0.742	2.885E-11	132	0.505	0.386	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
6	AFDB:F1MHQ4	0.954	0.734	2.885E-11	132	0.505	0.386	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
7	AFDB:O97788	0.956	0.735	3.589E-11	132	0.495	0.379	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
8	PDB:3nr3A	0.949	0.715	3.740E-11	135	0.515	0.385	3nr3A.pdb.gz
9	AFDB:P24526	0.952	0.732	4.228E-11	132	0.475	0.364	P24526.pdb.gz	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
10	AFDB:P02689	0.951	0.732	4.465E-11	132	0.515	0.394	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
11	AFDB:P04117	0.955	0.735	4.465E-11	132	0.485	0.371	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
12	PDB:3p6dA	0.941	0.690	6.456E-11	139	0.485	0.353	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
13	PDB:2qm9A	0.949	0.694	9.990E-11	139	0.485	0.353	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
14	AFDB:A6NFH5	0.959	0.697	1.069E-10	140	0.495	0.357	A6NFH5.pdb.gz	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
15	PDB:4a60A	0.938	0.679	2.668E-10	141	0.446	0.319	4a60A.pdb.gz
16	PDB:5hz9A	0.954	0.719	2.818E-10	135	0.426	0.319	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
17	AFDB:Q0Z7S8	0.958	0.738	3.016E-10	132	0.446	0.341	Q0Z7S8.pdb.gz	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
18	PDB:7yf1A	0.955	0.729	5.729E-10	133	0.406	0.308	7yf1A.pdb.gz
19	PDB:7e25A	0.945	0.692	8.395E-10	139	0.416	0.302	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
20	PDB:5bvsA	0.946	0.730	1.372E-9	132	0.505	0.386	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01469	5.13e-63	189	135	0.911	0.681	FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3
2	P55052	8.23e-58	176	135	0.842	0.630	FABP5_BOVIN Fatty acid-binding protein 5 OS=Bos taurus OX=9913 GN=FABP5 PE=1 SV=4
3	P55053	1.02e-54	168	135	0.792	0.593	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
4	Q05816	3.86e-54	166	135	0.762	0.570	FABP5_MOUSE Fatty acid-binding protein 5 OS=Mus musculus OX=10090 GN=Fabp5 PE=1 SV=3
5	P48035	1.86e-30	106	132	0.505	0.386	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
6	F1MHQ4	2.58e-30	106	132	0.505	0.386	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
7	P02689	8.97e-30	105	132	0.515	0.394	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
8	O97788	6.26e-29	102	132	0.495	0.379	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
9	A0A0K0MJN3	9.17e-29	102	132	0.505	0.386	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
10	P24526	1.51e-28	102	132	0.475	0.364	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
11	A6NFH5	3.40e-28	101	140	0.495	0.357	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
12	P15090	2.14e-27	99.0	132	0.485	0.371	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
13	Q0Z7S8	6.59e-27	97.8	132	0.446	0.341	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
14	P04117	7.59e-27	97.8	132	0.485	0.371	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
15	P07483	3.02e-24	90.9	133	0.446	0.338	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
16	P70623	3.44e-23	88.2	132	0.426	0.326	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
17	P05413	4.11e-23	88.2	133	0.426	0.323	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
18	Q66I80	1.41e-22	86.7	134	0.455	0.343	Q66I80_DANRE Fatty acid binding protein 11a OS=Danio rerio OX=7955 GN=fabp11 PE=1 SV=1
19	P55054	2.69e-22	85.9	132	0.386	0.295	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
20	P11404	7.75e-22	84.7	133	0.406	0.308	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	4.8e-06	38.3	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815828.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003808572.1	0.780	Peroxisome proliferator-activated receptor delta isoform X1
2	9597.XP_008977038.1	0.773	Transgelin 3
3	9597.XP_003830103.1	0.678	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
4	9597.XP_003811803.1	0.677	Lipase E, hormone sensitive type
5	9597.XP_008949962.1	0.655	Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proin [...]
6	9597.XP_003819190.1	0.633	Diazepam binding inhibitor, acyl-CoA binding protein
7	9597.XP_003823674.1	0.624	Key enzyme in triglyceride metabolism. Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and very low density lipoproteins (VLDL), and thereby plays an important role in lipid clearance from the blood stream, lipid utilization and storage. Mediates margination of triglyceride-rich lipoprotein particles in capillaries. Recruited to its site of action on the luminal surface of vascular endothelium by binding to GPIHBP1 and cell surface heparan sulfate proteoglycans
8	9597.XP_003805902.1	0.620	Fatty acid binding protein 1
9	9597.XP_003823746.1	0.611	Glutamic-oxaloacetic transaminase 2
10	9597.XP_003819051.1	0.592	Fatty acid binding protein 6
11	9597.XP_003812430.1	0.586	Peroxisome proliferator activated receptor alpha
12	9597.XP_003813496.1	0.586	Aldo-keto reductase family 1 member B
13	9597.XP_008969444.1	0.586	Uncharacterized protein LOC100970792
14	9597.XP_003813145.1	0.577	Belongs to the ubiquitin-conjugating enzyme family.
15	9597.XP_003811663.1	0.571	Belongs to the acyl-CoA oxidase family.
16	9597.XP_003813311.1	0.571	Belongs to the acyl-CoA oxidase family.
17	9597.XP_003827071.1	0.564	FK506 binding protein 1B
18	9597.XP_008972981.1	0.564	FK506 binding protein 1A
19	9597.XP_003808355.1	0.547	Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family
20	9597.XP_008974288.1	0.546	Retinoic acid receptor RXR-alpha isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0033293	1.000	monocarboxylic acid binding
GO:0005515	0.990	protein binding
GO:0005504	0.989	fatty acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.775	developmental process
GO:0048856	0.774	anatomical structure development
GO:0032501	0.712	multicellular organismal process
GO:0009987	0.631	cellular process
GO:0065007	0.454	biological regulation
GO:0050789	0.416	regulation of biological process
GO:0008152	0.408	metabolic process
GO:0071704	0.395	organic substance metabolic process
GO:0044238	0.373	primary metabolic process
GO:0050794	0.334	regulation of cellular process
GO:0044237	0.327	cellular metabolic process
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0005634	0.985	nucleus
GO:0070013	0.916	intracellular organelle lumen
GO:0005576	0.850	extracellular region
GO:0005829	0.827	cytosol
GO:0005654	0.640	nucleoplasm
GO:0005615	0.596	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]