StarFunc result for job id A8MVS5

User Input

>input (230 residues)
MPWTILLFAAGSLAIPAPSIRLVPPYPSSQEDPIHIACMAPGNFPGANFTLYRGGQVVQL
LQAPTDQRGVTFNLSGGSSKAPGGPFHCQYGVLGELNQSQLSDLSEPVNVSFPVPTWILV
LSLSLAGALFLLAGLVAVALVVRKVKLRNLQKKRDRESCWAQINFDSTDMSFDNSLFTVS
AKTMPEEDPATLDDHSGTTATPSNSRTRKRPTSTSSSPETPEFSTFRACQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MVS5	0.999	0.999	1.289E-37	230	1.000	1.000	A8MVS5.pdb.gz	HIDE1_HUMAN Protein HIDE1 OS=Homo sapiens OX=9606 GN=HIDE1 PE=1 SV=2
2	AFDB:Q3TB92	0.400	0.378	1.891E-6	246	0.170	0.159	Q3TB92.pdb.gz	MILR1_MOUSE Allergin-1 OS=Mus musculus OX=10090 GN=Milr1 PE=1 SV=2
3	AFDB:Q6UX27	0.328	0.320	3.346E-6	236	0.161	0.157	Q6UX27.pdb.gz	VSTM1_HUMAN V-set and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSTM1 PE=1 SV=2
4	AFDB:Q7Z6M3	0.377	0.278	8.335E-6	343	0.174	0.117	Q7Z6M3.pdb.gz	MILR1_HUMAN Allergin-1 OS=Homo sapiens OX=9606 GN=MILR1 PE=1 SV=2
5	AFDB:Q6DN72	0.343	0.190	1.475E-5	434	0.165	0.088	Q6DN72.pdb.gz	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
6	AFDB:A0A0D5CDW0	0.346	0.259	1.653E-5	333	0.165	0.114	A0A0D5CDW0.pdb.gz	A0A0D5CDW0_ICTPU SLAM family member 7 precursor OS=Ictalurus punctatus OX=7998 GN=slamf7 PE=2 SV=1
7	AFDB:P16284	0.328	0.118	3.673E-5	738	0.113	0.035	P16284.pdb.gz	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
8	AFDB:P97484	0.292	0.092	4.359E-5	841	0.191	0.052	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
9	AFDB:P08920	0.307	0.241	4.615E-5	344	0.152	0.102	P08920.pdb.gz	CD2_MOUSE T-cell surface antigen CD2 OS=Mus musculus OX=10090 GN=Cd2 PE=1 SV=1
10	AFDB:P08921	0.304	0.218	4.615E-5	344	0.174	0.116	P08921.pdb.gz	CD2_RAT T-cell surface antigen CD2 OS=Rattus norvegicus OX=10116 GN=Cd2 PE=1 SV=2
11	PDB:8e4cC	0.230	0.303	7.537E-3	142	0.096	0.155	8e4cC.pdb.gz
12	PDB:1ezvX	0.271	0.442	1.495E-2	127	0.065	0.118	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
13	PDB:7u7nC	0.250	0.278	1.773E-2	200	0.087	0.100	7u7nC.pdb.gz
14	PDB:6hd8A	0.301	0.164	3.942E-2	461	0.065	0.033	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
15	PDB:5ir3A	0.237	0.413	5.243E-2	111	0.048	0.099	5ir3A.pdb.gz
16	PDB:4pygA	0.236	0.098	5.550E-2	685	0.057	0.019	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
17	PDB:7z0lB	0.230	0.160	6.221E-2	370	0.087	0.054	7z0lB.pdb.gz
18	PDB:5lkhA	0.272	0.079	6.973E-2	948	0.026	0.006	5lkhA.pdb.gz
19	PDB:3zhlA	0.260	0.437	7.382E-2	121	0.052	0.099	3zhlA.pdb.gz
20	PDB:6cplA	0.213	0.259	7.816E-2	180	0.070	0.089	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MVS5	6.02e-171	471	230	1.000	1.000	HIDE1_HUMAN Protein HIDE1 OS=Homo sapiens OX=9606 GN=HIDE1 PE=1 SV=2
2	Q6TQR6	0.33	34.7	3945	0.087	0.005	L_CCHFI RNA-directed RNA polymerase L OS=Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) OX=652961 GN=L PE=1 SV=3
3	Q9W3W0	0.43	34.3	1123	0.143	0.029	Q9W3W0_DROME Inactive OS=Drosophila melanogaster OX=7227 GN=iav PE=4 SV=1
4	P08101	0.78	33.1	330	0.148	0.103	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
5	Q9FFE6	0.81	33.1	552	0.083	0.034	AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=AAE5 PE=1 SV=1
6	Q80VA2	1.3	32.3	689	0.183	0.061	Q80VA2_MOUSE Fat1 protein (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=2 SV=1
7	P10121	1.4	32.3	497	0.078	0.036	FTSY_ECOLI Signal recognition particle receptor FtsY OS=Escherichia coli (strain K12) OX=83333 GN=ftsY PE=1 SV=1
8	Q80XT9	2.2	32.0	1209	0.187	0.036	Q80XT9_MOUSE Fat1 protein (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=2 SV=1
9	O82266	2.6	31.6	530	0.061	0.026	SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana OX=3702 GN=SWA1 PE=2 SV=1
10	Q497H5	2.8	31.6	1309	0.187	0.033	Q497H5_MOUSE Fat1 protein (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=2 SV=1
11	Q06321	3.1	31.6	1198	0.078	0.015	ATG26_YEAST Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1
12	Q7JFR0	4.0	30.4	189	0.061	0.074	Q7JFR0_MOUSE H2-M beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1
13	P9WQ43	4.1	30.8	583	0.122	0.048	FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD26 PE=1 SV=1
14	Q7TXM1	5.4	30.4	583	0.122	0.048	FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fadD26 PE=1 SV=1
15	Q9Y5G3	5.9	30.4	927	0.091	0.023	PCDGD_HUMAN Protocadherin gamma-B1 OS=Homo sapiens OX=9606 GN=PCDHGB1 PE=1 SV=1
16	P70238	6.0	30.0	261	0.061	0.054	P70238_MOUSE MB2p protein OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1
17	B7ZNR4	6.2	30.0	261	0.061	0.054	B7ZNR4_MOUSE Histocompatibility 2, class II, locus Mb2 OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1
18	B7ZNR3	6.3	30.0	261	0.061	0.054	B7ZNR3_MOUSE Histocompatibility 2, class II, locus Mb2 OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1
19	P70241	6.3	30.0	261	0.061	0.054	P70241_MOUSE MB2w5 protein OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1
20	Q95552	6.4	30.0	261	0.061	0.054	Q95552_MOUSE MB2d protein OS=Mus musculus OX=10090 GN=H2-DMb2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16492 Cadherin_C_2	1.7e+02	14.3	Cadherin cytoplasmic C-terminal
2	PF14316 DUF4381	4.5e+02	12.5	Domain of unknown function (DUF4381)
3	PF19471 DUF6008	4.1e+02	11.8	Family of unknown function (DUF6008)
4	PF13895 Ig_2	0.82	21.3	Immunoglobulin domain
5	PF17737 Ig_C19orf38	2.1e-43	157.8	Ig domain in C19orf38 (HIDE1)
6	PF06305 LapA_dom	86	14.4	Lipopolysaccharide assembly protein A domain
7	PF06936 Selenoprotein_S	5.5e+02	11.8	Selenoprotein S (SelS)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10029.XP_007629785.1

Rank	PPI partner	STRING score	Description
1	10029.XP_007638132.1	0.550	PRAME family member 20/21-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048583	0.970	regulation of response to stimulus
GO:0048522	0.925	positive regulation of cellular process
GO:0002682	0.886	regulation of immune system process
GO:0019222	0.731	regulation of metabolic process
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:0048519	0.558	negative regulation of biological process
GO:0031323	0.549	regulation of cellular metabolic process
GO:0010468	0.539	regulation of gene expression
GO:0051171	0.536	regulation of nitrogen compound metabolic process
GO:0080090	0.535	regulation of primary metabolic process
GO:0030155	0.527	regulation of cell adhesion
GO:0002694	0.473	regulation of leukocyte activation
GO:0009893	0.407	positive regulation of metabolic process
GO:0050896	0.400	response to stimulus
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0050776	0.398	regulation of immune response
GO:0022407	0.381	regulation of cell-cell adhesion
GO:0031325	0.358	positive regulation of cellular metabolic process
GO:0051173	0.355	positive regulation of nitrogen compound metabolic process
GO:0006355	0.352	regulation of DNA-templated transcription
GO:0071704	0.327	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005622	0.982	intracellular anatomical structure
GO:0071944	0.971	cell periphery
GO:0005737	0.961	cytoplasm
GO:0005886	0.959	plasma membrane
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0031090	0.840	organelle membrane
GO:0012505	0.445	endomembrane system
GO:0070013	0.349	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]