StarFunc result for job id A8MVU1

User Input

>input (366 residues)
MYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQ
RAAENHQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKD
GKSTATDITGPIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGW
IPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWW
VIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAY
RRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKR
KLASAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14598	0.567	0.534	1.039E-64	390	0.992	0.931	P14598.pdb.gz	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
2	AFDB:Q09014	0.524	0.493	7.840E-57	390	0.809	0.759	Q09014.pdb.gz	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
3	AFDB:B5X4S7	0.520	0.464	2.041E-44	413	0.533	0.472	B5X4S7.pdb.gz	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
4	AFDB:A2BFP2	0.544	0.490	9.958E-44	410	0.555	0.495	A2BFP2.pdb.gz
5	AFDB:A1X283	0.337	0.139	4.307E-25	911	0.301	0.121	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
6	AFDB:A2AAY5	0.276	0.113	2.623E-23	908	0.290	0.117	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
7	AFDB:Q5TCZ1	0.275	0.091	4.656E-22	1133	0.279	0.090	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
8	AFDB:Q1LYG0	0.272	0.095	3.231E-21	1119	0.284	0.093	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
9	AFDB:Q8NFA2	0.263	0.256	6.281E-18	376	0.235	0.229	Q8NFA2.pdb.gz	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
10	AFDB:Q8VCM2	0.268	0.280	2.032E-17	349	0.246	0.258	Q8VCM2.pdb.gz	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
11	PDB:2dybA	0.228	0.276	5.095E-8	298	0.137	0.168	2dybA.pdb.gz
12	PDB:1griA	0.144	0.245	3.443E-5	211	0.085	0.147	1griA.pdb.gz
13	PDB:2eyzA	0.168	0.196	7.831E-5	304	0.101	0.122	2eyzA.pdb.gz
14	PDB:2lqnA	0.157	0.184	1.114E-4	303	0.090	0.109	2lqnA.pdb.gz
15	PDB:2h8hA	0.151	0.124	3.204E-4	445	0.077	0.063	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:1k9aB	0.148	0.123	5.763E-4	441	0.049	0.041	1k9aB.pdb.gz
17	PDB:3ehqA	0.149	0.291	6.873E-4	182	0.044	0.088	3ehqA.pdb.gz
18	PDB:4mt6A	0.135	0.127	2.500E-3	389	0.049	0.046	4mt6A.pdb.gz
19	PDB:3qwyA	0.149	0.313	3.162E-3	170	0.057	0.124	3qwyA.pdb.gz
20	PDB:6x5hA	0.165	0.131	3.771E-3	467	0.038	0.030	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M707	0.0	627	389	0.809	0.761	NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus OX=10116 GN=Ncf1 PE=1 SV=2
2	P14598	0.0	753	390	0.992	0.931	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
3	Q09014	0.0	626	390	0.809	0.759	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
4	B8YQ98	1.34e-138	402	413	0.536	0.475	B8YQ98_SALSA NADPH oxidase cytosolic protein OS=Salmo salar OX=8030 GN=p47phox PE=2 SV=1
5	Q4Z8P3	2.39e-138	401	410	0.533	0.476	Q4Z8P3_DANRE Neutrophil cytosol factor 1 OS=Danio rerio OX=7955 GN=cb893 PE=2 SV=1
6	B5X4S7	3.08e-138	401	413	0.538	0.477	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
7	A1X283	1.77e-50	183	911	0.262	0.105	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
8	A2AAY5	5.52e-50	181	908	0.260	0.105	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
9	O89032	4.81e-49	179	1124	0.265	0.086	SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh3pxd2a PE=1 SV=2
10	Q5TCZ1	4.97e-49	179	1133	0.265	0.086	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
11	Q1LYG0	2.92e-46	171	1119	0.246	0.080	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
12	Q8NFA2	2.33e-24	104	376	0.199	0.194	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
13	Q8VCM2	1.60e-20	93.6	349	0.199	0.209	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
14	Q9NZM3	3.72e-13	73.2	1697	0.117	0.025	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
15	Q9Z0R6	7.94e-12	69.3	1659	0.134	0.030	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
16	H0YKF1	3.09e-10	59.7	133	0.066	0.180	H0YKF1_HUMAN Proline-serine-threonine phosphatase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1
17	Q9Z0R4	1.78e-09	62.0	1714	0.117	0.025	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
18	O61639	1.85e-09	61.6	1011	0.117	0.043	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
19	M9PDC7	1.86e-09	61.6	1005	0.117	0.043	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
20	Q8INU2	1.87e-09	61.6	1014	0.117	0.042	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	53	15.8	Helically-extended SH3 domain
2	PF16621 NECFESHC	5.1e-18	76.0	SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
3	PF08944 p47_phox_C	1.3e-16	71.0	NADPH oxidase subunit p47Phox, C terminal domain
4	PF00787 PX	7.2e-14	63.6	PX domain
5	PF00018 SH3_1	9e-26	100.6	SH3 domain
6	PF07653 SH3_2	5.8e-14	63.0	Variant SH3 domain
7	PF08239 SH3_3	10	17.9	Bacterial SH3 domain
8	PF12913 SH3_6	1.2e+02	13.6	SH3 domain (SH3b1 type)
9	PF14604 SH3_9	1.7e-18	77.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033000

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000002950	0.999	Uncharacterized protein
2	9598.ENSPTRP00000014422	0.996	Cytochrome b-245 light chain
3	9598.ENSPTRP00000047447	0.992	Uncharacterized protein
4	9598.ENSPTRP00000013479	0.984	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
5	9598.ENSPTRP00000024681	0.975	Uncharacterized protein
6	9598.ENSPTRP00000025952	0.974	Calcium-independent, phospholipid- and diacylglycerol (DAG)- dependent serine/threonine-protein kinase that plays contrasting roles in cell death and cell survival by functioning as a pro-apoptotic protein during DNA damage-induced apoptosis, but acting as an anti- apoptotic protein during cytokine receptor-initiated cell death, is involved in tumor suppression
7	9598.ENSPTRP00000016236	0.965	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
8	9598.ENSPTRP00000019651	0.940	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
9	9598.ENSPTRP00000043465	0.939	NADPH oxidase activator 1
10	9598.ENSPTRP00000031968	0.936	Uncharacterized protein
11	9598.ENSPTRP00000030915	0.935	Mitogen-activated protein kinase 14
12	9598.ENSPTRP00000001735	0.932	Uncharacterized protein
13	9598.ENSPTRP00000023334	0.927	Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
14	9598.ENSPTRP00000053615	0.911	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
15	9598.ENSPTRP00000013860	0.908	Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
16	9598.ENSPTRP00000051401	0.905	NADPH oxidase, EF-hand calcium binding domain 5
17	9598.ENSPTRP00000047715	0.897	NADPH oxidase 4
18	9598.ENSPTRP00000060141	0.897	Uncharacterized protein
19	9598.ENSPTRP00000024313	0.885	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
20	9598.ENSPTRP00000043196	0.874	Pan troglodytes ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008289	0.969	lipid binding
GO:0005543	0.946	phospholipid binding
GO:0043167	0.929	ion binding
GO:0043168	0.924	anion binding
GO:0035091	0.909	phosphatidylinositol binding
GO:0003824	0.889	catalytic activity
GO:0043325	0.846	phosphatidylinositol-3,4-bisphosphate binding
GO:0098772	0.597	molecular function regulator activity
GO:0008047	0.570	enzyme activator activity
GO:0016176	0.499	superoxide-generating NADPH oxidase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0048583	0.990	regulation of response to stimulus
GO:0008152	0.986	metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0072593	0.960	reactive oxygen species metabolic process
GO:0050794	0.956	regulation of cellular process
GO:0048522	0.952	positive regulation of cellular process
GO:0006950	0.919	response to stress
GO:0051716	0.904	cellular response to stimulus
GO:0060255	0.889	regulation of macromolecule metabolic process
GO:0042221	0.885	response to chemical
GO:0080134	0.854	regulation of response to stress
GO:0044419	0.828	biological process involved in interspecies interaction between organisms
GO:0009607	0.811	response to biotic stimulus
GO:0048584	0.811	positive regulation of response to stimulus
GO:0009605	0.800	response to external stimulus
GO:1901700	0.790	response to oxygen-containing compound
GO:0070887	0.789	cellular response to chemical stimulus
GO:0009966	0.776	regulation of signal transduction
GO:0031323	0.759	regulation of cellular metabolic process
GO:0006801	0.710	superoxide metabolic process
GO:0080090	0.618	regulation of primary metabolic process
GO:0051171	0.614	regulation of nitrogen compound metabolic process
GO:0009893	0.612	positive regulation of metabolic process
GO:0006952	0.567	defense response
GO:1902531	0.562	regulation of intracellular signal transduction
GO:0071704	0.559	organic substance metabolic process
GO:0043207	0.557	response to external biotic stimulus
GO:0031325	0.555	positive regulation of cellular metabolic process
GO:0010604	0.487	positive regulation of macromolecule metabolic process
GO:0065009	0.480	regulation of molecular function
GO:0051246	0.472	regulation of protein metabolic process
GO:0050790	0.453	regulation of catalytic activity
GO:0051179	0.438	localization
GO:0009967	0.430	positive regulation of signal transduction
GO:0010468	0.429	regulation of gene expression
GO:0007154	0.425	cell communication
GO:0023052	0.418	signaling
GO:0002376	0.416	immune system process
GO:0042325	0.388	regulation of phosphorylation
GO:0051707	0.383	response to other organism
GO:1901701	0.380	cellular response to oxygen-containing compound
GO:0001932	0.372	regulation of protein phosphorylation
GO:0032501	0.371	multicellular organismal process
GO:0044238	0.367	primary metabolic process
GO:0007165	0.359	signal transduction
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0051239	0.335	regulation of multicellular organismal process
GO:0010033	0.329	response to organic substance
GO:0048519	0.328	negative regulation of biological process
GO:0051247	0.326	positive regulation of protein metabolic process
GO:0044093	0.323	positive regulation of molecular function
GO:0048523	0.309	negative regulation of cellular process
GO:0002682	0.304	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.998	cytosol
GO:0071944	0.986	cell periphery
GO:0043226	0.982	organelle
GO:0005886	0.960	plasma membrane
GO:0043229	0.951	intracellular organelle
GO:0043227	0.935	membrane-bounded organelle
GO:0043231	0.923	intracellular membrane-bounded organelle
GO:0032991	0.909	protein-containing complex
GO:0031982	0.848	vesicle
GO:0031410	0.747	cytoplasmic vesicle
GO:0098797	0.663	plasma membrane protein complex
GO:1902494	0.641	catalytic complex
GO:1990204	0.415	oxidoreductase complex
GO:0012505	0.323	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]