StarFunc result for job id A8MVX0

User Input

>input (844 residues)
MEKTKTKQGENEHMPVNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKTQKEEHSSQAGPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDS
NVKGMMGPGVNPTTPEAEENLKSCLSADIQSKGHLPSGMWRQPKDGKEWGEEYVTKDHPD
KLKEAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
RNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVA
YLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDY
YLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANAGQDASP
TAGPEAVRDTGIHSEELLQPYPSAPSSGPAITHLMPPVKKSQQQQSLMESMQPGKPSDWE
LEGRKHERPESLLAPTQFCAAEQDVKALAGPLQAIPEMDFESSPAEPLGNVERSLRAPAE
LLPDARGFVPAAYEEFEYGGEIFALPAPYDEEPFQAPALFENCSPASSESSLDICFLRPV
SFAMEAERPEHPLQPLPKSATSPAGSSSAYKLEAAAQAHGKAKPLSRSLKEFPRAPPADG
VAPRLYSTRSSSGGRAPIKAERAAQAHGPAAAAVAARGASRTFFPQQRSQSEKQTYLEVR
REMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKNGNATGEDFCGP
WGWW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2K7P776	0.071	0.070	1.288E-6	867	0.150	0.146	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:O42874	0.055	0.038	5.665E-6	1462	0.128	0.074	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
3	PDB:7rx9A	0.178	0.329	6.408E-6	432	0.039	0.076	7rx9A.pdb.gz
4	AFDB:P51123	0.083	0.039	4.009E-5	2129	0.143	0.057	P51123.pdb.gz	TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster OX=7227 GN=Taf1 PE=1 SV=3
5	AFDB:Q6P3W6	0.062	0.062	4.954E-5	841	0.143	0.144	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
6	AFDB:Q5YL88	0.056	0.041	5.507E-5	1205	0.150	0.105	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
7	AFDB:A0A0B4KFZ2	0.093	0.074	6.454E-5	1161	0.113	0.082	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
8	AFDB:P0DPF3	0.064	0.050	6.804E-5	1111	0.142	0.108	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
9	AFDB:Q9HGL2	0.055	0.043	7.975E-5	1116	0.134	0.101	Q9HGL2.pdb.gz	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
10	AFDB:Q6XZL8	0.056	0.035	1.586E-4	1540	0.156	0.086	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
11	PDB:4mt6A	0.173	0.352	3.569E-4	389	0.039	0.085	4mt6A.pdb.gz
12	AFDB:Q17602	0.084	0.055	6.615E-4	1390	0.147	0.089	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
13	PDB:4gouA	0.171	0.273	2.044E-3	507	0.043	0.071	4gouA.pdb.gz
14	PDB:6ikoA	0.077	0.190	1.139E-1	303	0.039	0.109	6ikoA.pdb.gz
15	PDB:7p5jA	0.073	0.124	1.833E-1	399	0.039	0.083	7p5jA.pdb.gz
16	PDB:6xz6A	0.067	0.196	2.037E-1	213	0.026	0.103	6xz6A.pdb.gz
17	PDB:6wczA	0.071	0.148	2.798E-1	350	0.026	0.063	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
18	PDB:1tt9A	0.116	0.164	2.950E-1	540	0.034	0.054	1tt9A.pdb.gz
19	PDB:5sv0A	0.061	0.184	3.645E-1	233	0.034	0.124	5sv0A.pdb.gz
20	PDB:3c98B	0.081	0.208	4.052E-1	230	0.032	0.117	3c98B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q54YZ6	5.99e-07	55.8	1218	0.055	0.038	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
2	Q54DW7	8.12e-07	55.5	986	0.062	0.053	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
3	Q1ZXH8	2.79e-06	53.9	1632	0.052	0.027	GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum OX=44689 GN=gxcDD PE=4 SV=3
4	Q54DW4	1.63e-05	51.2	1350	0.052	0.033	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
5	O15013	7.73e-05	48.9	1369	0.051	0.031	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
6	Q96PE2	8.35e-05	48.9	2063	0.053	0.022	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
7	Q9HCE6	1.51e-04	48.1	1279	0.036	0.023	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
8	Q5JSP0	2.41e-04	47.4	725	0.066	0.077	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
9	M9PHU0	3.00e-04	47.4	2263	0.049	0.018	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
10	F1LXF1	3.77e-04	46.6	1270	0.064	0.043	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
11	P52734	5.80e-04	46.2	960	0.052	0.046	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
12	E1JJN5	5.95e-04	46.2	1736	0.049	0.024	E1JJN5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=2
13	P98174	6.31e-04	45.8	961	0.052	0.046	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
14	Q54P24	8.59e-04	45.4	1215	0.049	0.034	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
15	E2RP94	0.001	45.4	1583	0.072	0.039	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
16	M9PEZ9	0.001	45.1	1563	0.049	0.026	M9PEZ9_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=1
17	P11274	0.001	45.1	1271	0.064	0.042	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
18	Q6PAJ1	0.001	45.4	1270	0.064	0.043	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
19	Q91ZT5	0.001	45.1	766	0.056	0.061	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
20	Q9VX48	0.001	45.4	1458	0.049	0.028	Q9VX48_DROME SD02996p OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09824 ArsR	52	14.9	ArsR transcriptional regulator
2	PF14661 HAUS6_N	1.4e+02	13.5	HAUS augmin-like complex subunit 6 N-terminus
3	PF00103 Hormone_1	66	14.7	Somatotropin hormone family
4	PF00621 RhoGEF	2.4e-10	52.5	RhoGEF domain
5	PF08581 Tup_N	91	14.8	Tup N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000056494

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000048293	0.616	Ras homolog family member G
2	9598.ENSPTRP00000060141	0.596	Uncharacterized protein
3	9598.ENSPTRP00000024681	0.561	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140677	0.956	molecular function activator activity
GO:0140678	0.900	molecular function inhibitor activity
GO:0005085	0.887	guanyl-nucleotide exchange factor activity
GO:0019899	0.390	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.954	cellular process
GO:0023051	0.891	regulation of signaling
GO:0010646	0.891	regulation of cell communication
GO:0048583	0.890	regulation of response to stimulus
GO:0009966	0.872	regulation of signal transduction
GO:1902531	0.799	regulation of intracellular signal transduction
GO:0051056	0.671	regulation of small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0071944	0.965	cell periphery
GO:0005886	0.950	plasma membrane
GO:0043226	0.949	organelle
GO:0043229	0.808	intracellular organelle
GO:0043227	0.722	membrane-bounded organelle
GO:0043231	0.516	intracellular membrane-bounded organelle
GO:0043232	0.388	intracellular non-membrane-bounded organelle
GO:0030054	0.376	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]