StarFunc result for job id A8MVZ5

User Input

>input (291 residues)
MAVTCDPEAFLSICFVTLVFLQLPLASIWKADFDVTGPHAPILAMAGGHVELQCQLFPNI
SAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTT
FDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVER
RDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLP
ATFSRSSQFTAWKAALPLILVAMGLVIAGGICIFWKRQREKNKASLEEERE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVV5	0.708	0.403	5.666E-28	523	0.347	0.193	Q8WVV5.pdb.gz	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
2	AFDB:Q62556	0.748	0.430	8.681E-28	524	0.351	0.195	Q62556.pdb.gz	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
3	AFDB:Q13410	0.789	0.456	9.157E-28	526	0.357	0.198	Q13410.pdb.gz	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
4	AFDB:Q7TST0	0.835	0.488	1.019E-27	509	0.306	0.175	Q7TST0.pdb.gz	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
5	AFDB:Q7KYR7	0.709	0.399	2.038E-27	527	0.357	0.197	Q7KYR7.pdb.gz	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
6	AFDB:A4QPC6	0.689	0.399	4.536E-27	514	0.326	0.185	A4QPC6.pdb.gz	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
7	AFDB:O00478	0.719	0.374	1.250E-26	584	0.364	0.182	O00478.pdb.gz	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
8	AFDB:Q6UXG8	0.692	0.389	2.020E-26	535	0.299	0.163	Q6UXG8.pdb.gz	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
9	AFDB:O00481	0.707	0.413	7.266E-26	513	0.351	0.199	O00481.pdb.gz	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
10	AFDB:A0A0G2K9U4	0.633	0.613	8.527E-26	303	0.309	0.297	A0A0G2K9U4.pdb.gz	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
11	PDB:5c7kF	0.317	0.412	5.254E-11	212	0.107	0.146	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:1i7zA	0.349	0.445	9.448E-11	219	0.096	0.128	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
13	PDB:1uwxL	0.317	0.418	1.448E-10	211	0.110	0.152	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
14	PDB:1fdlL	0.306	0.397	1.611E-10	214	0.103	0.140	1fdlL.pdb.gz
15	PDB:1k4dB	0.311	0.408	1.699E-10	212	0.113	0.156	1k4dB.pdb.gz
16	PDB:3c2aL	0.284	0.369	1.699E-10	216	0.124	0.167	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
17	PDB:1cicA	0.315	0.408	1.994E-10	214	0.100	0.136	1cicA.pdb.gz
18	PDB:6dcvA	0.342	0.434	2.218E-10	220	0.079	0.105	6dcvA.pdb.gz
19	PDB:1kcsL	0.296	0.383	2.340E-10	214	0.113	0.154	1kcsL.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
20	PDB:6vpyL	0.305	0.411	2.603E-10	209	0.117	0.163	6vpyL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7KYR7	4.72e-51	177	527	0.340	0.188	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
2	O00478	5.54e-49	173	584	0.368	0.183	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
3	Q13410	8.65e-48	169	526	0.337	0.186	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
4	Q8WVV5	2.43e-47	167	523	0.330	0.184	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
5	P78410	4.50e-47	162	334	0.354	0.308	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
6	Q62556	5.23e-45	161	524	0.316	0.176	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
7	A4QPC6	6.08e-43	155	514	0.302	0.171	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
8	O00481	1.17e-41	152	513	0.323	0.183	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
9	M0RD77	1.05e-39	142	313	0.320	0.297	M0RD77_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=1
10	A0A0G2K9U4	4.05e-39	142	346	0.326	0.275	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
11	Q6MG92	1.49e-37	142	588	0.340	0.168	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
12	A7TZE6	6.20e-36	134	364	0.289	0.231	SKIT1_MOUSE Selection and upkeep of intraepithelial T-cells protein 1 OS=Mus musculus OX=10090 GN=Skint1 PE=1 SV=1
13	A2CG22	5.99e-35	134	539	0.289	0.156	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
14	Q9UIR0	7.87e-35	132	455	0.254	0.163	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
15	Q7TST0	3.07e-34	132	509	0.268	0.153	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
16	Q6UXG8	8.20e-33	128	535	0.244	0.133	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
17	O70355	1.83e-31	123	454	0.261	0.167	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
18	Q6UXE8	4.43e-26	108	466	0.299	0.187	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2
19	Q921X1	1.96e-23	96.3	179	0.168	0.274	Q921X1_MOUSE Btn1a1 protein OS=Mus musculus OX=10090 GN=Btn1a1 PE=2 SV=1
20	Q6UX41	1.79e-22	99.0	500	0.265	0.154	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11384 DUF3188	2.1e+02	13.0	Protein of unknown function (DUF3188)
2	PF07686 V-set	2.5e-05	35.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005541141.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005554278.1	0.595	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.965	regulation of cellular process
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0010468	0.808	regulation of gene expression
GO:0048519	0.682	negative regulation of biological process
GO:0009987	0.643	cellular process
GO:0002682	0.479	regulation of immune system process
GO:0051239	0.436	regulation of multicellular organismal process
GO:0048523	0.423	negative regulation of cellular process
GO:0050865	0.394	regulation of cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0110165	0.991	cellular anatomical entity
GO:0071944	0.984	cell periphery
GO:0016020	0.975	membrane
GO:0005886	0.956	plasma membrane
GO:0043232	0.476	intracellular non-membrane-bounded organelle
GO:0005634	0.468	nucleus
GO:0070013	0.467	intracellular organelle lumen
GO:0031981	0.462	nuclear lumen
GO:0032991	0.377	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]