StarFunc result for job id A8MW92

User Input

>input (1017 residues)
MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYW
DSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQF
YDGVIRCLKRMHIKAMPEDAKGQVKSQHPLSWCCPIDPAGSCNQSMGSEDWIALVKAAAA
AAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKEDLPTSSETF
GLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKED
YNETAPMLEQAISPKPQSQKKNEADISSSANTQKPALLSSTLSSGKARSKKCKHESGDSS
GCIKPPKSPLSPELIQVEDLTLVSQLSSSVINKTSPPQPVNPPRPFKHSERRRRSQRLAT
LPMPDDSVEKVSSPSPATDGKVFSISSQNQQESSVPEVPDVAHLPLEKLGPCLPLDLSRG
SEVTAPVASDSSYRNECPRAEKEDTQMLPNPSSKAIADGRGAPAAAGISKTEKKVKLEDK
SSTAFGKRKEKDKERREKRDKDHYRPKQKKKKKKKKKSKQHDYSDYEDSSLEFLERCSSP
LTRSSGSSLASRSMFTEKTTTYQYPRAILSVDLSGENLSDVDFLDDSSTESLLLSGDEYN
QDFDSTNFEESQDEDDALNEIVRCICEMDEENGFMIQCEECLCWQHSVCMGLLEESIPEQ
YICYICRDPPGQRWSAKYRYDKEWLNNGRMCGLSFFKENYSHLNAKKIVSTHHLLADVYG
VTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQ
NHKEPPRLPLKMEGTYITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRS
KNSLQYSAKEHGMPEKNPAEGNTVFVYNDKKGTEDPGDSHLQWQLNLLTHIENVQNEVTS
RMDLIEKEVDVLESWLDFTGELEPPDPLARLPQLKRHIKQLLIDMGKVQQIATLCSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MW92	1.000	1.000	0.000	1017	1.000	1.000	A8MW92.pdb.gz	P20L1_HUMAN PHD finger protein 20-like protein 1 OS=Homo sapiens OX=9606 GN=PHF20L1 PE=1 SV=2
2	AFDB:Q8BLG0	0.219	0.220	1.248E-57	1010	0.353	0.355	Q8BLG0.pdb.gz	PHF20_MOUSE PHD finger protein 20 OS=Mus musculus OX=10090 GN=Phf20 PE=1 SV=2
3	AFDB:Q9BVI0	0.165	0.166	5.104E-56	1012	0.366	0.368	Q9BVI0.pdb.gz	PHF20_HUMAN PHD finger protein 20 OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
4	AFDB:Q86AD8	0.056	0.049	3.178E-5	1207	0.121	0.102	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
5	PDB:3mp8A	0.050	0.097	3.681E-5	513	0.025	0.049	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
6	AFDB:B1AVB3	0.059	0.062	4.247E-5	969	0.107	0.112	B1AVB3.pdb.gz	B1AVB3_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
7	AFDB:B1AVB4	0.060	0.071	4.500E-5	845	0.095	0.115	B1AVB4.pdb.gz	B1AVB4_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
8	AFDB:F1QHE7	0.058	0.044	2.716E-4	1358	0.107	0.080	F1QHE7.pdb.gz
9	AFDB:Q9VA36	0.053	0.062	4.076E-4	882	0.126	0.145	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
10	AFDB:M0RDF1	0.057	0.036	1.951E-3	1724	0.129	0.076	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
11	PDB:6tedZ	0.053	0.089	3.199E-3	510	0.016	0.031	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	PDB:7okyZ	0.048	0.121	7.635E-3	374	0.011	0.029	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
13	PDB:2ns2A	0.051	0.219	1.081E-2	201	0.020	0.100	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
14	PDB:7abi7	0.051	0.200	1.081E-2	236	0.013	0.055	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:4pa0B	0.044	0.048	1.445E-2	920	0.009	0.010	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
16	AFDB:Q9M9N3	0.064	0.081	1.484E-2	769	0.108	0.143	Q9M9N3.pdb.gz	Q9M9N3_ARATH T17B22.17 protein OS=Arabidopsis thaliana OX=3702 GN=PWO1 PE=1 SV=1
17	PDB:4pa0A	0.044	0.046	1.931E-2	974	0.009	0.009	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
18	PDB:4zn3A	0.048	0.298	3.448E-2	147	0.009	0.061	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
19	PDB:6s01K	0.056	0.516	3.448E-2	86	0.012	0.140	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
20	PDB:7r1dC	0.056	0.262	3.448E-2	192	0.011	0.057	7r1dC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MW92	0.0	2110	1017	1.000	1.000	P20L1_HUMAN PHD finger protein 20-like protein 1 OS=Homo sapiens OX=9606 GN=PHF20L1 PE=1 SV=2
2	Q9BVI0	1.84e-108	363	1012	0.206	0.207	PHF20_HUMAN PHD finger protein 20 OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
3	Q8BLG0	3.64e-104	351	1010	0.198	0.199	PHF20_MOUSE PHD finger protein 20 OS=Mus musculus OX=10090 GN=Phf20 PE=1 SV=2
4	Q5JWZ0	5.03e-56	206	543	0.084	0.157	Q5JWZ0_HUMAN PHD finger protein 20 (Fragment) OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=1
5	Q5JXL1	6.07e-56	205	549	0.084	0.155	Q5JXL1_HUMAN PHD finger protein 20 (Fragment) OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
6	Q7KSN0	1.39e-29	129	1081	0.054	0.051	Q7KSN0_DROME SD10773p OS=Drosophila melanogaster OX=7227 GN=MBD-R2 PE=2 SV=1
7	Q9VGA4	2.39e-29	129	1169	0.054	0.047	Q9VGA4_DROME MBD-R2 OS=Drosophila melanogaster OX=7227 GN=MBD-R2 PE=1 SV=2
8	Q9VUB5	1.58e-11	71.6	3146	0.022	0.007	Q9VUB5_DROME UpSET, isoform A OS=Drosophila melanogaster OX=7227 GN=upSET PE=1 SV=3
9	Q10362	2.78e-10	67.0	859	0.021	0.024	SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set3 PE=1 SV=1
10	Q8IZD2	2.88e-09	63.9	1858	0.029	0.016	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
11	Q1MTR4	3.31e-09	62.8	424	0.034	0.083	CTI6_SCHPO Putative histone deacetylase complex subunit cti6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cti6 PE=1 SV=1
12	Q9Y7V2	3.70e-09	63.2	721	0.022	0.031	BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bye1 PE=3 SV=3
13	Q3UG20	4.25e-09	63.5	1868	0.026	0.014	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
14	Q9NR48	1.37e-08	61.6	2969	0.026	0.009	ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens OX=9606 GN=ASH1L PE=1 SV=2
15	A0A1D8PFV9	2.62e-08	60.5	1069	0.023	0.022	A0A1D8PFV9_CANAL Histone-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SET3 PE=4 SV=1
16	Q08923	2.69e-08	60.1	506	0.022	0.043	CTI6_YEAST Histone deacetylase complex subunit CTI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTI6 PE=1 SV=1
17	Q99MY8	3.71e-08	60.5	2958	0.025	0.008	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
18	P36124	4.35e-08	59.7	751	0.021	0.028	SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SET3 PE=1 SV=1
19	Q9U263	1.69e-07	58.2	1645	0.026	0.016	SET26_CAEEL Histone-lysine N-methyltransferase set-26 OS=Caenorhabditis elegans OX=6239 GN=set-26 PE=1 SV=3
20	O44498	1.73e-07	58.2	1623	0.026	0.016	SET9_CAEEL Histone-lysine N-methyltransferase set-9 OS=Caenorhabditis elegans OX=6239 GN=set-9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12618 DUF3776	2.8e-08	45.4	Protein of unknown function (DUF3776)
2	PF15057 DUF4537	63	14.9	Domain of unknown function (DUF4537)
3	PF02820 MBT	0.0093	27.6	mbt repeat
4	PF00628 PHD	0.0063	27.7	PHD-finger
5	PF16660 PHD20L1_u1	1.1e-47	172.0	PHD finger protein 20-like protein 1
6	PF18104 Tudor_2	5.1e-05	34.2	Jumonji domain-containing protein 2A Tudor domain
7	PF18115 Tudor_3	0.0051	28.0	DNA repair protein Crb2 Tudor domain
8	PF18358 Tudor_4	37	15.3	Histone methyltransferase Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378784

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256429	0.881	Methyl-CpG-binding domain protein 2
2	9606.ENSP00000369716	0.859	Chromodomain-helicase-DNA-binding protein 3
3	9606.ENSP00000333633	0.856	Metastasis-associated protein MTA1
4	9606.ENSP00000353463	0.855	Transcriptional repressor p66-alpha
5	9606.ENSP00000349508	0.841	Chromodomain-helicase-DNA-binding protein 4
6	9606.ENSP00000412302	0.835	Methyl-CpG-binding domain protein 3
7	9606.ENSP00000383973	0.815	Metastasis-associated protein MTA3
8	9606.ENSP00000338774	0.810	B-cell lymphoma/leukemia 11A
9	9606.ENSP00000357644	0.809	Transcriptional repressor p66-beta
10	9606.ENSP00000362649	0.792	Histone deacetylase 1
11	9606.ENSP00000396976	0.754	Bromo adjacent homology domain-containing 1 protein
12	9606.ENSP00000385795	0.753	PHD finger protein 14
13	9606.ENSP00000306324	0.737	PWWP domain containing 2B
14	9606.ENSP00000369424	0.737	Histone-binding protein RBBP7
15	9606.ENSP00000393795	0.726	Zinc finger protein 512B
16	9606.ENSP00000278823	0.714	Metastasis-associated protein MTA2
17	9606.ENSP00000371133	0.704	High mobility group protein 20A
18	9606.ENSP00000357594	0.702	Calcium homeostasis modulator protein 6
19	9606.ENSP00000329102	0.683	Protein lin-9 homolog
20	9606.ENSP00000307208	0.671	Nucleosome-remodeling factor subunit BPTF

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140034	1.000	methylation-dependent protein binding
GO:0042393	0.654	histone binding
GO:0035064	0.454	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:1903050	0.966	regulation of proteolysis involved in protein catabolic process
GO:0051248	0.952	negative regulation of protein metabolic process
GO:0031324	0.951	negative regulation of cellular metabolic process
GO:0009895	0.933	negative regulation of catabolic process
GO:0042176	0.924	regulation of protein catabolic process
GO:1903051	0.919	negative regulation of proteolysis involved in protein catabolic process
GO:0061136	0.899	regulation of proteasomal protein catabolic process
GO:0031330	0.869	negative regulation of cellular catabolic process
GO:0042177	0.794	negative regulation of protein catabolic process
GO:2000058	0.755	regulation of ubiquitin-dependent protein catabolic process
GO:0032434	0.729	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0019219	0.555	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.546	regulation of gene expression
GO:0009889	0.507	regulation of biosynthetic process
GO:0051252	0.503	regulation of RNA metabolic process
GO:0032435	0.467	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0031326	0.451	regulation of cellular biosynthetic process
GO:0010556	0.450	regulation of macromolecule biosynthetic process
GO:0006355	0.439	regulation of DNA-templated transcription
GO:0009987	0.426	cellular process
GO:0048518	0.373	positive regulation of biological process
GO:0071704	0.356	organic substance metabolic process
GO:0009893	0.355	positive regulation of metabolic process
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0032991	0.980	protein-containing complex
GO:0005737	0.955	cytoplasm
GO:0012505	0.950	endomembrane system
GO:0005829	0.914	cytosol
GO:0000785	0.903	chromatin
GO:0140513	0.870	nuclear protein-containing complex
GO:0016020	0.859	membrane
GO:1902494	0.810	catalytic complex
GO:0031090	0.757	organelle membrane
GO:0000123	0.726	histone acetyltransferase complex
GO:0035097	0.691	histone methyltransferase complex
GO:1902562	0.524	H4 histone acetyltransferase complex
GO:0031975	0.431	envelope
GO:0031967	0.423	organelle envelope
GO:0044545	0.386	NSL complex
GO:0005635	0.383	nuclear envelope
GO:0031965	0.338	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]