StarFunc result for job id A8MW95

User Input

>input (431 residues)
MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQD
GASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEE
CTDSLLEQLDIQLALTEADSQNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQEL
EDVDRNNARAAADLQAAQAEAAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYAR
VQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA
NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRAMVAFLDCMQQ
FKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW
SLIWVASRYQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MW95	1.000	1.000	2.382E-67	431	1.000	1.000	A8MW95.pdb.gz	BECN2_HUMAN Beclin-2 OS=Homo sapiens OX=9606 GN=BECN2 PE=1 SV=2
2	AFDB:A0A024R1X5	0.564	0.543	2.524E-40	450	0.566	0.542	A0A024R1X5.pdb.gz	A0A024R1X5_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=2 SV=1
3	AFDB:P0DM65	0.700	0.678	5.301E-40	447	0.529	0.510	P0DM65.pdb.gz	BECN2_MOUSE Beclin-2 OS=Mus musculus OX=10090 GN=Becn2 PE=1 SV=2
4	AFDB:F1RCP1	0.645	0.623	1.660E-39	447	0.490	0.472	F1RCP1.pdb.gz	BECN1_DANRE Beclin-1 OS=Danio rerio OX=7955 GN=becn1 PE=2 SV=3
5	AFDB:Q9VCE1	0.523	0.533	2.724E-29	422	0.339	0.346	Q9VCE1.pdb.gz	BECN1_DROME Beclin-1-like protein OS=Drosophila melanogaster OX=7227 GN=Atg6 PE=1 SV=1
6	PDB:7bl1EEE	0.469	0.577	3.359E-27	337	0.476	0.608	7bl1EEE.pdb.gz	Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.
7	AFDB:Q9M367	0.541	0.461	2.477E-24	517	0.292	0.244	Q9M367.pdb.gz	BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana OX=3702 GN=ATG6 PE=1 SV=2
8	AFDB:P87117	0.510	0.479	6.058E-23	464	0.269	0.250	P87117.pdb.gz	BECN1_SCHPO Vacuolar protein sorting-associated protein atg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg6 PE=3 SV=4
9	AFDB:Q02948	0.512	0.410	1.454E-20	557	0.234	0.181	Q02948.pdb.gz	BECN1_YEAST Vacuolar protein sorting-associated protein 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS30 PE=1 SV=1
10	AFDB:Q22592	0.594	0.677	3.624E-20	375	0.237	0.272	Q22592.pdb.gz	BECN_CAEEL Beclin homolog OS=Caenorhabditis elegans OX=6239 GN=bec-1 PE=1 SV=2
11	AFDB:Q55CC5	0.561	0.185	5.723E-17	1368	0.234	0.074	Q55CC5.pdb.gz	BECNA_DICDI Beclin-1-like protein A OS=Dictyostelium discoideum OX=44689 GN=atg6A PE=3 SV=1
12	PDB:5dfzD	0.506	0.613	3.360E-12	341	0.195	0.246	5dfzD.pdb.gz
13	PDB:5dfzA	0.179	0.216	1.136	343	0.077	0.096	5dfzA.pdb.gz
14	PDB:7bl1AAA	0.141	0.155	1.203	380	0.111	0.126	7bl1AAA.pdb.gz	Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.
15	PDB:3fbrA	0.102	0.102	1.694	436	0.065	0.064	3fbrA.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
16	PDB:4y0hD	0.104	0.099	1.899	463	0.046	0.043	4y0hD.pdb.gz	Mechanism of inactivation of gamma-aminobutyric acid aminotransferase by (1S,3S)-3-amino-4-difluoromethylenyl-1-cyclopentanoic acid (CPP-115)
17	PDB:5jwaA	0.063	0.057	2.011	495	0.019	0.016	5jwaA.pdb.gz	Target Elucidation by Cocrystal Structures of NADH-Ubiquinone Oxidoreductase of Plasmodium falciparum (PfNDH2) with Small Molecule To Eliminate Drug-Resistant Malaria
18	PDB:6zekC	0.074	0.069	2.129	478	0.039	0.036	6zekC.pdb.gz	Structure and substrate specificity determinants of the taurine biosynthetic enzyme cysteine sulphinic acid decarboxylase.
19	PDB:5ft8A	0.073	0.078	2.386	401	0.021	0.022	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
20	PDB:1gncA	0.097	0.191	2.832	175	0.035	0.086	1gncA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MW95	0.0	888	431	1.000	1.000	BECN2_HUMAN Beclin-2 OS=Homo sapiens OX=9606 GN=BECN2 PE=1 SV=2
2	O88597	9.99e-162	465	448	0.566	0.545	BECN1_MOUSE Beclin-1 OS=Mus musculus OX=10090 GN=Becn1 PE=1 SV=3
3	A0A024R1X5	1.26e-159	459	450	0.566	0.542	A0A024R1X5_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=2 SV=1
4	Q14457	1.26e-159	459	450	0.566	0.542	BECN1_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=1 SV=2
5	Q91XJ1	3.69e-159	458	448	0.559	0.538	BECN1_RAT Beclin-1 OS=Rattus norvegicus OX=10116 GN=Becn1 PE=1 SV=1
6	Q4A1L4	5.90e-159	457	448	0.561	0.540	BECN1_BOVIN Beclin-1 OS=Bos taurus OX=9913 GN=BECN1 PE=1 SV=1
7	F6PQC7	3.77e-156	451	473	0.568	0.518	F6PQC7_MACMU Beclin-1 OS=Macaca mulatta OX=9544 GN=BECN1 PE=3 SV=3
8	F1RCP1	1.22e-140	411	447	0.487	0.470	BECN1_DANRE Beclin-1 OS=Danio rerio OX=7955 GN=becn1 PE=2 SV=3
9	P0DM65	1.52e-139	408	447	0.543	0.523	BECN2_MOUSE Beclin-2 OS=Mus musculus OX=10090 GN=Becn2 PE=1 SV=2
10	Q9VCE1	2.29e-89	279	422	0.390	0.398	BECN1_DROME Beclin-1-like protein OS=Drosophila melanogaster OX=7227 GN=Atg6 PE=1 SV=1
11	Q9M367	4.18e-46	168	517	0.306	0.255	BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana OX=3702 GN=ATG6 PE=1 SV=2
12	P87117	3.92e-40	151	464	0.295	0.274	BECN1_SCHPO Vacuolar protein sorting-associated protein atg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg6 PE=3 SV=4
13	Q22592	5.15e-28	116	375	0.216	0.248	BECN_CAEEL Beclin homolog OS=Caenorhabditis elegans OX=6239 GN=bec-1 PE=1 SV=2
14	Q02948	6.60e-24	106	557	0.225	0.174	BECN1_YEAST Vacuolar protein sorting-associated protein 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS30 PE=1 SV=1
15	Q55CC5	6.26e-23	104	1368	0.174	0.055	BECNA_DICDI Beclin-1-like protein A OS=Dictyostelium discoideum OX=44689 GN=atg6A PE=3 SV=1
16	Q8MSG8	0.20	36.6	662	0.097	0.063	APTX_DROME Aprataxin-like protein OS=Drosophila melanogaster OX=7227 GN=CG5316 PE=2 SV=2
17	Q8IDX6	0.49	35.4	3130	0.081	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	Q20060	1.7	33.5	1549	0.079	0.022	SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans OX=6239 GN=smc-4 PE=1 SV=1
19	Q7Z443	2.0	33.5	1732	0.056	0.014	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
20	Q0ZME7	2.1	33.5	1351	0.044	0.014	SPIKE_CVHN5 Spike glycoprotein OS=Human coronavirus HKU1 (isolate N5) OX=443241 GN=S PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04111 APG6	8.6e-56	200.2	Apg6 BARA domain
2	PF17675 APG6_N	6.9e-23	93.0	Apg6 coiled-coil region
3	PF03961 FapA	9e+02	10.9	Flagellar Assembly Protein A beta solenoid domain
4	PF13851 GAS	5.3	17.9	Growth-arrest specific micro-tubule binding
5	PF03854 zf-P11	2.2e+02	12.9	P-11 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008976465.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003830260.1	0.994	Phosphatidylinositol 3-kinase catalytic subunit type 3
2	9597.XP_003829493.1	0.993	Phosphoinositide 3-kinase regulatory subunit 4 isoform X1
3	9597.XP_003831728.1	0.992	Beclin 1-associated autophagy-related key regulator
4	9597.XP_003814757.2	0.991	UV radiation resistance associated
5	9597.XP_008965547.1	0.963	Unc-51 like autophagy activating kinase 1
6	9597.XP_003823303.1	0.953	RB1-inducible coiled-coil protein 1 isoform X1
7	9597.XP_008953162.1	0.945	GABA type A receptor associated protein like 2
8	9597.XP_008957620.1	0.939	Unc-51 like autophagy activating kinase 2
9	9597.XP_003810165.1	0.914	Gamma-aminobutyric acid receptor-associated protein
10	9597.XP_003830362.1	0.913	Nuclear receptor binding factor 2
11	9597.XP_003831121.1	0.913	Autophagy related 101
12	9597.XP_008958109.1	0.913	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 ESTs, 9 Proteins, and 27% coverage of the annotated genomic feature by RNAseq alignments
13	9597.XP_008973470.1	0.913	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
14	9597.XP_003813027.2	0.904	Huntingtin
15	9597.XP_008965316.1	0.903	PTEN induced putative kinase 1
16	9597.XP_008953234.1	0.899	Gamma-aminobutyric acid receptor-associated protein-like 1 isoform X1
17	9597.XP_003814810.1	0.889	BCL2 like 1
18	9597.XP_008950955.1	0.889	Apoptosis regulator Bcl-2
19	9597.XP_003832824.1	0.880	Ataxin 3
20	9597.XP_008972180.1	0.880	Putative ataxin-3-like protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.987	negative regulation of biological process
GO:0061919	0.986	process utilizing autophagic mechanism
GO:0044248	0.986	cellular catabolic process
GO:0023051	0.981	regulation of signaling
GO:0006914	0.976	autophagy
GO:0007041	0.959	lysosomal transport
GO:0048583	0.949	regulation of response to stimulus
GO:0010646	0.948	regulation of cell communication
GO:0009966	0.939	regulation of signal transduction
GO:0071704	0.883	organic substance metabolic process
GO:0008333	0.864	endosome to lysosome transport
GO:0045744	0.819	negative regulation of G protein-coupled receptor signaling pathway
GO:0043112	0.672	receptor metabolic process
GO:1901575	0.643	organic substance catabolic process
GO:0009057	0.502	macromolecule catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.980	cytosol
GO:0012505	0.968	endomembrane system
GO:0070013	0.950	intracellular organelle lumen
GO:0032991	0.942	protein-containing complex
GO:0031981	0.934	nuclear lumen
GO:0031410	0.845	cytoplasmic vesicle
GO:0005654	0.694	nucleoplasm
GO:0019898	0.637	extrinsic component of membrane
GO:0098796	0.583	membrane protein complex
GO:1990234	0.547	transferase complex
GO:0061695	0.498	transferase complex, transferring phosphorus-containing groups
GO:0005942	0.411	phosphatidylinositol 3-kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]