StarFunc result for job id A8MWA6

User Input

>input (464 residues)
MMARRDPKSWAKRLVRAQTLQKQRRARVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVL
ASLSPLRKTSLSSSSSLGPKERQTGAAADMPQPAVRHQGPEPLLEVKPTHSRPEGGCQEV
PQAASKTHGLLQASRPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKKPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHSAAGHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.360	0.360	2.552E-56	464	0.914	0.914	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q6FUW3	0.065	0.036	8.941E-2	975	0.134	0.064	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
3	AFDB:Q8N1G0	0.070	0.030	6.283E-1	1237	0.183	0.069	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
4	AFDB:O00268	0.070	0.041	8.794E-1	1085	0.203	0.087	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
5	AFDB:Q0WQM3	0.058	0.041	9.406E-1	797	0.207	0.120	Q0WQM3.pdb.gz	Q0WQM3_ARATH Chaperone DnaJ-domain superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SDJ3 PE=1 SV=1
6	PDB:6edtJ	0.062	0.220	1.170	109	0.028	0.119	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
7	AFDB:P13360	0.065	0.055	1.316	604	0.151	0.116	P13360.pdb.gz	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
8	AFDB:Q9NRM1	0.059	0.028	1.723	1142	0.198	0.081	Q9NRM1.pdb.gz	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
9	PDB:5hutA	0.040	0.040	1.873	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
10	AFDB:Q9QX47	0.069	0.022	1.970	2444	0.162	0.031	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
11	AFDB:E9QAP7	0.071	0.048	2.254	1042	0.185	0.083	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
12	PDB:3zqjF	0.046	0.036	2.292	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
13	AFDB:Q9QWH1	0.070	0.044	2.411	850	0.188	0.102	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
14	PDB:7p5xAJ	0.054	0.263	3.208	89	0.032	0.169	7p5xAJ.pdb.gz	Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
15	PDB:4v8mBj	0.049	0.135	3.431	161	0.017	0.050	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:7mq8L8	0.039	0.097	3.431	180	0.015	0.039	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3sucA	0.045	0.028	3.925	767	0.013	0.008	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
18	PDB:3zqqC	0.048	0.150	4.198	134	0.013	0.045	3zqqC.pdb.gz
19	PDB:6i9ra	0.057	0.245	4.198	83	0.013	0.072	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
20	PDB:7y9tA	0.052	0.063	4.198	380	0.015	0.018	7y9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	800	464	0.914	0.914	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
6	P04585	0.53	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
7	P03366	0.60	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
8	P04590	0.73	34.7	522	0.058	0.052	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
9	P05888	0.93	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.1	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	G5EF97	3.2	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
13	P49025	3.9	32.7	2055	0.043	0.010	CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus OX=10090 GN=Cit PE=1 SV=3
14	P12497	4.0	32.7	1435	0.056	0.018	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
15	E9PSL7	4.1	32.7	2055	0.043	0.010	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
16	Q8IZX4	4.6	32.3	1826	0.082	0.021	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
17	Q9JHD2	5.5	32.0	830	0.045	0.025	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
18	Q92830	5.6	32.0	837	0.045	0.025	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
19	D4ACX5	6.0	32.0	833	0.045	0.025	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
20	P35963	6.2	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1e+02	14.4	Zinc knuckle
2	PF15288 zf-CCHC_6	1e-19	81.4	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.457	catalytic activity
GO:0016740	0.414	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0043170	0.979	macromolecule metabolic process
GO:0019222	0.947	regulation of metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0048522	0.886	positive regulation of cellular process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0080090	0.827	regulation of primary metabolic process
GO:0009893	0.796	positive regulation of metabolic process
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0019219	0.779	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.736	regulation of RNA metabolic process
GO:0010468	0.691	regulation of gene expression
GO:0031326	0.685	regulation of cellular biosynthetic process
GO:0010556	0.684	regulation of macromolecule biosynthetic process
GO:0031325	0.677	positive regulation of cellular metabolic process
GO:1903506	0.666	regulation of nucleic acid-templated transcription
GO:0006355	0.657	regulation of DNA-templated transcription
GO:0044260	0.647	cellular macromolecule metabolic process
GO:0010604	0.628	positive regulation of macromolecule metabolic process
GO:0034641	0.623	cellular nitrogen compound metabolic process
GO:0051173	0.611	positive regulation of nitrogen compound metabolic process
GO:0045935	0.551	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.432	positive regulation of DNA-templated transcription
GO:1901564	0.408	organonitrogen compound metabolic process
GO:0019538	0.397	protein metabolic process
GO:0043412	0.396	macromolecule modification
GO:0006139	0.386	nucleobase-containing compound metabolic process
GO:0036211	0.343	protein modification process
GO:0090304	0.301	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.985	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005694	0.953	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.414	Transferases.

[back to server]