StarFunc result for job id A8MWK0

User Input

>input (482 residues)
MKFEEKCGDNGSIVGRNQSYPGEKHQPKGKPIANGEAEVYAKQEANGKCSTPRKSLSMYT
WLEIQRHNHEADQLVINCKVYNVSSWADRHPGGHQVLNHCAGEDAMDVFRAMHPELDIVQ
LYLKPLLIGELAPGEPSQERHKNSQLVKDFQELWSIAEAMNMFHANLGFFFLHFVQILIL
EVLAWLIVYHFGSGWPVTMFISFLLTISQASSSFLQHDAGHLSIFRKSKWNHVVHKFVMC
HLKGLSADRWNYWHFEQHVKPNIYPKDPDIDTDPLFLLGDSQPVKYGKKKIKYINYEEQH
LYFYKVWLPLFMPVYLKLPSMQAMYLQRYWVCFSLQDITWVSSFYIYFITFGLYYGIFGT
MLLIYLVKFLESPWIVYVTQMSHITMRMSTEENRDWLTTQVLATCNTESFFNDFTGHLNF
QIEHHLFPTMPRHNYHKVAPLVRSLCAKHGLHYVNKPMLRAFGDIVRALKKSAALWADAY
YE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z0R9	0.867	0.939	2.629E-44	444	0.488	0.529	Q9Z0R9.pdb.gz	FADS2_MOUSE Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1
2	AFDB:O95864	0.861	0.933	3.924E-44	444	0.488	0.529	O95864.pdb.gz	FADS2_HUMAN Acyl-CoA 6-desaturase OS=Homo sapiens OX=9606 GN=FADS2 PE=1 SV=1
3	AFDB:Q4TVM9	0.868	0.934	8.359E-44	447	0.467	0.503	Q4TVM9.pdb.gz	Q4TVM9_GADMO Delta-6 fatty acyl desaturase OS=Gadus morhua OX=8049 GN=Fadsd6 PE=2 SV=1
4	AFDB:I3NL78	0.859	0.930	2.542E-43	445	0.473	0.512	I3NL78.pdb.gz	I3NL78_SPAAU Delta 6 desaturase OS=Sparus aurata OX=8175 PE=2 SV=1
5	AFDB:D2KE02	0.860	0.906	6.765E-43	457	0.477	0.503	D2KE02.pdb.gz	D2KE02_SALSA Delta-6 fatty acyl desaturase OS=Salmo salar OX=8030 GN=D6fad_b PE=2 SV=1
6	AFDB:B7U6V1	0.862	0.938	1.206E-42	442	0.461	0.502	B7U6V1.pdb.gz	B7U6V1_RACCA Delta-6 fatty acyl desaturase OS=Rachycentron canadum OX=141264 GN=fadsd6 PE=2 SV=1
7	AFDB:Q9Y5Q0	0.859	0.929	4.582E-42	445	0.465	0.503	Q9Y5Q0.pdb.gz	FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens OX=9606 GN=FADS3 PE=1 SV=1
8	AFDB:Q6QDP0	0.862	0.933	4.791E-42	445	0.461	0.499	Q6QDP0.pdb.gz	Q6QDP0_SCOMX Delta-6 fatty acyl desaturase OS=Scophthalmus maximus OX=52904 GN=Fadsd6 PE=2 SV=1
9	AFDB:Q9DEX7	0.860	0.932	5.724E-42	444	0.444	0.482	Q9DEX7.pdb.gz	FADS2_DANRE Acyl-CoA 6-desaturase OS=Danio rerio OX=7955 GN=fads2 PE=1 SV=1
10	AFDB:Q9DEX6	0.858	0.930	2.174E-41	444	0.438	0.475	Q9DEX6.pdb.gz	Q9DEX6_CYPCA Putative delta-6 fatty acyl desaturase OS=Cyprinus carpio OX=7962 GN=Fadsd6 PE=2 SV=1
11	PDB:1t0gA	0.131	0.465	1.862E-1	109	0.031	0.138	1t0gA.pdb.gz
12	PDB:6r7xA	0.120	0.104	2.326E-1	629	0.091	0.070	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
13	PDB:3b9yA	0.112	0.126	1.056	388	0.081	0.101	3b9yA.pdb.gz
14	PDB:7f6hA	0.103	0.146	1.056	305	0.060	0.095	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
15	PDB:7r89B	0.100	0.093	1.056	529	0.095	0.087	7r89B.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
16	PDB:6gdgA	0.091	0.146	1.154	264	0.062	0.114	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.
17	PDB:7p54A	0.084	0.096	1.207	397	0.122	0.149	7p54A.pdb.gz
18	PDB:4k1cA	0.138	0.158	1.261	374	0.077	0.099	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
19	PDB:7sqoR	0.086	0.139	1.261	270	0.071	0.126	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
20	PDB:7f53R	0.140	0.204	1.379	273	0.056	0.099	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Z0R9	1.30e-169	487	444	0.496	0.538	FADS2_MOUSE Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1
2	O95864	2.21e-168	484	444	0.494	0.536	FADS2_HUMAN Acyl-CoA 6-desaturase OS=Homo sapiens OX=9606 GN=FADS2 PE=1 SV=1
3	Q9Z122	1.54e-167	481	444	0.492	0.534	FADS2_RAT Acyl-CoA 6-desaturase OS=Rattus norvegicus OX=10116 GN=Fads2 PE=1 SV=1
4	Q8AY64	2.02e-161	466	445	0.485	0.526	Q8AY64_SPAAU Fatty acid desaturase 2 OS=Sparus aurata OX=8175 GN=FD6D PE=2 SV=1
5	I3NL78	2.77e-161	466	445	0.485	0.526	I3NL78_SPAAU Delta 6 desaturase OS=Sparus aurata OX=8175 PE=2 SV=1
6	B7U6V1	1.09e-158	459	442	0.469	0.511	B7U6V1_RACCA Delta-6 fatty acyl desaturase OS=Rachycentron canadum OX=141264 GN=fadsd6 PE=2 SV=1
7	Q4TVM9	1.50e-157	456	447	0.477	0.515	Q4TVM9_GADMO Delta-6 fatty acyl desaturase OS=Gadus morhua OX=8049 GN=Fadsd6 PE=2 SV=1
8	D2KE03	4.77e-157	455	457	0.481	0.508	D2KE03_SALSA Delta-6 fatty acyl desaturase OS=Salmo salar OX=8030 GN=D6fad_c PE=2 SV=1
9	Q6QDP0	5.13e-157	455	445	0.463	0.501	Q6QDP0_SCOMX Delta-6 fatty acyl desaturase OS=Scophthalmus maximus OX=52904 GN=Fadsd6 PE=2 SV=1
10	D2KE02	1.20e-156	454	457	0.475	0.501	D2KE02_SALSA Delta-6 fatty acyl desaturase OS=Salmo salar OX=8030 GN=D6fad_b PE=2 SV=1
11	Q8QGE2	1.98e-156	454	454	0.483	0.513	Q8QGE2_SALSA Delta-5 fatty acyl desaturase OS=Salmo salar OX=8030 GN=Fadsd5 PE=2 SV=2
12	Q9DEX7	3.21e-153	445	444	0.454	0.493	FADS2_DANRE Acyl-CoA 6-desaturase OS=Danio rerio OX=7955 GN=fads2 PE=1 SV=1
13	Q6SES0	4.87e-153	445	454	0.471	0.500	Q6SES0_SALSA Delta-6 fatty acyl desaturase OS=Salmo salar OX=8030 GN=fadsd6 PE=2 SV=1
14	Q9Y5Q0	6.67e-151	439	445	0.461	0.499	FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens OX=9606 GN=FADS3 PE=1 SV=1
15	Q98SW7	5.05e-150	437	454	0.465	0.493	Q98SW7_ONCMY Delta 6-desaturase-like OS=Oncorhynchus mykiss OX=8022 GN=FD6D PE=2 SV=1
16	Q9DEX6	9.05e-146	426	444	0.446	0.484	Q9DEX6_CYPCA Putative delta-6 fatty acyl desaturase OS=Cyprinus carpio OX=7962 GN=Fadsd6 PE=2 SV=1
17	O60427	4.23e-132	391	444	0.438	0.475	FADS1_HUMAN Acyl-CoA (8-3)-desaturase OS=Homo sapiens OX=9606 GN=FADS1 PE=1 SV=3
18	A4UVI1	1.83e-129	384	444	0.440	0.477	FADS1_PAPAN Acyl-CoA (8-3)-desaturase OS=Papio anubis OX=9555 GN=FADS1 PE=1 SV=1
19	Q920L1	6.39e-127	378	447	0.436	0.470	FADS1_MOUSE Acyl-CoA (8-3)-desaturase OS=Mus musculus OX=10090 GN=Fads1 PE=1 SV=1
20	Q920R3	1.33e-125	375	447	0.436	0.470	FADS1_RAT Acyl-CoA (8-3)-desaturase OS=Rattus norvegicus OX=10116 GN=Fads1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00173 Cyt-b5	4.1e-11	54.2	Cytochrome b5-like Heme/Steroid binding domain
2	PF00487 FA_desaturase	5.2e-27	106.9	Fatty acid desaturase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005577934.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005552785.1	0.829	Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of [...]
2	9541.XP_005574486.1	0.815	Uncharacterized protein
3	9541.XP_005594405.1	0.779	long-chain-fatty-acid--CoA ligase 4 isoform X1
4	9541.XP_005556462.1	0.775	Uncharacterized protein
5	9541.XP_005557764.1	0.774	acyl-CoA synthetase long-chain family member 6
6	9541.XP_005591460.1	0.761	Acyl-coenzyme A synthetase ACSM1, mitochondrial
7	9541.XP_005591469.1	0.759	Acyl-coenzyme A synthetase ACSM3, mitochondrial
8	9541.XP_005559577.1	0.722	Very long-chain acyl-CoA synthetase isoform X1
9	9541.XP_005590672.1	0.722	Uncharacterized protein
10	9541.XP_005554099.1	0.677	Elongation of very long chain fatty acids protein 2 isoform X1
11	9541.XP_005560257.1	0.637	Catalyzes the conversion of fatty acids such as long-chain and very long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids
12	9541.XP_005587743.1	0.637	Uncharacterized protein
13	9541.XP_005557026.1	0.605	Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate to the production o [...]
14	9541.XP_005592603.1	0.577	Catalyzes the hydroxylation of free fatty acids at the C-2 position to produce 2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis. FA2H is stereospecific for the production of (R)-2-hydroxy fatty acids (By similarity). Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath (By similarity). Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier (By similarity). Participates [...]
15	9541.XP_005567059.1	0.549	Uncharacterized protein
16	9541.XP_005547552.1	0.529	Peroxisomal acyl-coenzyme A oxidase 2 isoform X1
17	9541.XP_005557735.1	0.511	Long-chain fatty acid transport protein 6 isoform X1
18	9541.XP_005552550.1	0.508	Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of very long chain saturated (VLC-SFA) and polyunsaturated (PUFA) fatty acids that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May play a critical role in early brain and skin development

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016215	1.000	acyl-CoA desaturase activity
GO:0016213	0.772	linoleoyl-CoA desaturase activity
GO:0005488	0.731	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0006629	0.998	lipid metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0008610	0.994	lipid biosynthetic process
GO:0019752	0.994	carboxylic acid metabolic process
GO:0044255	0.993	cellular lipid metabolic process
GO:0072330	0.978	monocarboxylic acid biosynthetic process
GO:0006631	0.977	fatty acid metabolic process
GO:0006633	0.971	fatty acid biosynthetic process
GO:0033559	0.844	unsaturated fatty acid metabolic process
GO:0001676	0.794	long-chain fatty acid metabolic process
GO:0006636	0.547	unsaturated fatty acid biosynthetic process
GO:1901360	0.323	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0016020	0.994	membrane
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0012505	0.989	endomembrane system
GO:0005737	0.986	cytoplasm
GO:0031090	0.876	organelle membrane
GO:0005783	0.826	endoplasmic reticulum
GO:0005789	0.817	endoplasmic reticulum membrane
GO:0005886	0.401	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25416	1.000	AH2 + O2 + octadecanoyl-CoA = (9Z)-octadecenoyl-CoA + A + 2 H2O
EC:1.14.19.3	0.772	acyl-CoA 6-desaturase.

[back to server]