StarFunc result for job id A8MWP4

User Input

>input (228 residues)
MQRPHRRQSQMDAASTRAPPRPSAPQQGRRQPSMPGSAQCHHRPDPHPPAPGKKKSSPVG
RFFPASAMAPPWLPGIVSAAQLKPVLSDLPPHCTRAQCQPLTQRPHSLHLQDSRNASSLP
HKGWRCNFPLQGPAGLTHKSACVGRMGHCCGSAGNVPELSPRPASPRGQQVTQDGPLQTP
ELPSECNVGPVMSRQPFPEQSQQGECAIDPRGPPRLELSWGEDPLSGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60331	0.100	0.084	3.106	282	0.180	0.145	P60331.pdb.gz	KR101_HUMAN Keratin-associated protein 10-1 OS=Homo sapiens OX=9606 GN=KRTAP10-1 PE=2 SV=2
2	AFDB:A0A0G2K069	0.099	0.047	3.792	624	0.211	0.077	A0A0G2K069.pdb.gz	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
3	AFDB:B0V3S9	0.096	0.074	4.629	327	0.154	0.107	B0V3S9.pdb.gz
4	PDB:2k8pA	0.083	0.096	4.991	189	0.127	0.153	2k8pA.pdb.gz
5	AFDB:Q6SPF0	0.119	0.067	5.288	538	0.189	0.080	Q6SPF0.pdb.gz	SAMD1_HUMAN Sterile alpha motif domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAMD1 PE=1 SV=1
6	PDB:1u3nA	0.081	0.102	8.497	162	0.035	0.049	1u3nA.pdb.gz
7	AFDB:Q92754	0.116	0.068	9.003	450	0.180	0.091	Q92754.pdb.gz	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
8	PDB:3mp8A	0.084	0.041	9.706	513	0.013	0.006	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PJN3	0.52	33.9	1479	0.101	0.016	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
2	Q04439	0.79	33.1	1219	0.083	0.016	MYO5_YEAST Myosin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO5 PE=1 SV=1
3	G1UI16	5.3	30.8	1337	0.110	0.019	G1UI16_HUMAN SCC-112 protein, isoform CRA_b OS=Homo sapiens OX=9606 GN=PDS5A PE=2 SV=1
4	Q29RF7	5.3	30.8	1337	0.110	0.019	PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1
5	Q54G18	6.5	30.4	1115	0.088	0.018	GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum OX=44689 GN=gacW PE=3 SV=1
6	Q86B77	8.0	30.0	826	0.079	0.022	Q86B77_DROME Lipophorin receptor 2, isoform B OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1
7	Q9VBN2	8.4	30.0	1028	0.079	0.018	Q9VBN2_DROME Lipophorin receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=4
8	A8JRC4	9.7	30.0	1029	0.079	0.017	A8JRC4_DROME Lipophorin receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.909	biological regulation
GO:0019222	0.717	regulation of metabolic process
GO:0050794	0.542	regulation of cellular process
GO:0048519	0.439	negative regulation of biological process
GO:0032502	0.413	developmental process
GO:0032501	0.406	multicellular organismal process
GO:0060255	0.353	regulation of macromolecule metabolic process
GO:0010604	0.339	positive regulation of macromolecule metabolic process
GO:0006355	0.339	regulation of DNA-templated transcription
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0048856	0.331	anatomical structure development
GO:0010558	0.320	negative regulation of macromolecule biosynthetic process
GO:0051253	0.316	negative regulation of RNA metabolic process
GO:0031325	0.304	positive regulation of cellular metabolic process
GO:1902679	0.301	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.952	intracellular anatomical structure
GO:0043229	0.911	intracellular organelle
GO:0043227	0.896	membrane-bounded organelle
GO:0005634	0.887	nucleus
GO:0070013	0.529	intracellular organelle lumen
GO:0031981	0.302	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]