StarFunc result for job id A8MWY0

User Input

>input (1029 residues)
MLFRARGPVRGRGWGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSSSSRPLPP
CQEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCGEGTYSLGSGIKFDEWDELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSN
KPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKDYFQIHTPCDE
EGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNV
VESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPG
SKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSVGSLMNGPSFTSKGTKYFHFFNISLC
GHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSII
LADTFIGVTVETTLKNINIKEDMFPVPTSQIPDVHFFYKSSTATTSCINGRSTAVKMRCN
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYV
WNEPKWCIKGISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQ
LKTSRSPNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PB18	0.574	0.652	0.000	901	0.464	0.529	E9PB18.pdb.gz	E9PB18_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
2	AFDB:Q3UZV7	0.909	0.910	0.000	1028	0.933	0.934	Q3UZV7.pdb.gz	ELAP2_MOUSE Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Mus musculus OX=10090 GN=Elapor2 PE=1 SV=1
3	AFDB:Q6DDW2	0.795	0.820	0.000	995	0.692	0.716	Q6DDW2.pdb.gz	ELAP2_XENLA Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Xenopus laevis OX=8355 GN=elapor2 PE=1 SV=2
4	AFDB:Q6UXG2	0.795	0.806	0.000	1013	0.523	0.531	Q6UXG2.pdb.gz	ELAP1_HUMAN Endosome/lysosome-associated apoptosis and autophagy regulator 1 OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=2
5	PDB:5eiyB	0.085	0.125	1.232E-5	658	0.049	0.076	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
6	AFDB:H2DL88	0.120	0.185	3.692E-5	633	0.039	0.063	H2DL88.pdb.gz
7	PDB:7l2zF	0.083	0.122	3.794E-5	664	0.048	0.074	7l2zF.pdb.gz
8	PDB:7ufgB	0.091	0.083	1.868E-4	1182	0.058	0.051	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
9	PDB:3lxuX	0.087	0.075	2.362E-4	1217	0.047	0.039	3lxuX.pdb.gz
10	AFDB:Q91V88	0.108	0.184	3.191E-4	561	0.027	0.050	Q91V88.pdb.gz	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
11	PDB:1uijC	0.054	0.101	3.436E-4	346	0.025	0.075	1uijC.pdb.gz
12	PDB:1ipkC	0.058	0.113	3.601E-4	379	0.032	0.087	1ipkC.pdb.gz
13	PDB:2vqaA	0.054	0.121	3.955E-4	356	0.041	0.118	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
14	AFDB:Q6FII8	0.069	0.080	4.227E-4	866	0.096	0.114	Q6FII8.pdb.gz	Q6FII8_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PWP6 PE=4 SV=1
15	AFDB:Q6UXI9	0.108	0.181	4.227E-4	565	0.028	0.051	Q6UXI9.pdb.gz	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
16	AFDB:G5EDX3	0.097	0.106	4.643E-4	906	0.108	0.123	G5EDX3.pdb.gz	G5EDX3_CAEEL CUB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lev-10 PE=2 SV=1
17	PDB:6vlsD	0.095	0.101	5.000E-4	963	0.034	0.036	6vlsD.pdb.gz
18	PDB:4lejA	0.069	0.144	5.240E-4	355	0.037	0.107	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
19	AFDB:G5EBL2	0.054	0.055	1.365E-3	966	0.051	0.054	G5EBL2.pdb.gz	MES1_CAEEL Protein mes-1 OS=Caenorhabditis elegans OX=6239 GN=mes-1 PE=1 SV=1
20	PDB:6l4cB	0.055	0.116	1.470E-3	373	0.030	0.083	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PB18	0.0	993	901	0.461	0.526	E9PB18_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
2	Q3UZV7	0.0	2016	1028	0.934	0.935	ELAP2_MOUSE Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Mus musculus OX=10090 GN=Elapor2 PE=1 SV=1
3	Q6DDW2	0.0	1554	995	0.698	0.722	ELAP2_XENLA Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Xenopus laevis OX=8355 GN=elapor2 PE=1 SV=2
4	Q6UXG2	0.0	1142	1013	0.521	0.529	ELAP1_HUMAN Endosome/lysosome-associated apoptosis and autophagy regulator 1 OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=2
5	E9PLQ2	3.57e-59	203	205	0.090	0.454	E9PLQ2_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
6	Q20531	0.002	45.1	3514	0.047	0.014	Q20531_CAEEL C-type LECtin OS=Caenorhabditis elegans OX=6239 GN=clec-78 PE=1 SV=2
7	Q5G872	0.043	40.4	1010	0.053	0.054	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
8	O15230	0.062	40.0	3695	0.053	0.015	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
9	P28693	0.19	38.1	1004	0.027	0.028	EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3
10	F1R0I7	0.31	37.4	995	0.019	0.020	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
11	Q9Z0R7	0.45	37.0	843	0.038	0.046	TS1R2_RAT Taste receptor type 1 member 2 OS=Rattus norvegicus OX=10116 GN=Tas1r2 PE=2 SV=1
12	Q8IWY4	0.58	36.6	988	0.022	0.023	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
13	P54757	0.59	36.6	1005	0.023	0.024	EPHA5_RAT Ephrin type-A receptor 5 OS=Rattus norvegicus OX=10116 GN=Epha5 PE=1 SV=1
14	Q66PY1	0.62	36.6	993	0.020	0.021	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
15	Q8IX30	0.62	36.6	993	0.020	0.021	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
16	Q7RTX1	0.65	36.6	841	0.014	0.017	TS1R1_HUMAN Taste receptor type 1 member 1 OS=Homo sapiens OX=9606 GN=TAS1R1 PE=2 SV=1
17	P54753	0.70	36.2	998	0.027	0.028	EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens OX=9606 GN=EPHB3 PE=1 SV=2
18	Q9CQN1	0.76	36.2	706	0.026	0.038	TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus OX=10090 GN=Trap1 PE=1 SV=1
19	Q8K4Z6	0.91	35.8	928	0.026	0.029	GPC6A_MOUSE G-protein coupled receptor family C group 6 member A OS=Mus musculus OX=10090 GN=Gprc6a PE=1 SV=1
20	Q6NZL8	1.0	35.8	1018	0.017	0.018	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07699 Ephrin_rec_like	5e-05	34.3	Tyrosine-protein kinase ephrin type A/B receptor-like
2	PF07562 NCD3G	2.8	19.2	Nine Cysteines Domain of family 3 GPCR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413445

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307134	0.693	Catenin delta-2
2	9606.ENSP00000379168	0.558	Zinc finger protein 287
3	9606.ENSP00000398083	0.500	Transmembrane protein 243

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.987	signaling receptor binding
GO:0033612	0.951	receptor serine/threonine kinase binding
GO:0070696	0.943	transmembrane receptor protein serine/threonine kinase binding
GO:0070700	0.765	BMP receptor binding
GO:1901363	0.673	heterocyclic compound binding
GO:0097159	0.660	organic cyclic compound binding
GO:0003676	0.649	nucleic acid binding
GO:0003723	0.372	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0030513	0.991	positive regulation of BMP signaling pathway
GO:0009987	0.776	cellular process
GO:0008152	0.311	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.937	intracellular anatomical structure
GO:0043226	0.922	organelle
GO:0043227	0.810	membrane-bounded organelle
GO:0043231	0.703	intracellular membrane-bounded organelle
GO:0005737	0.642	cytoplasm
GO:0005634	0.431	nucleus
GO:0070013	0.413	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]