StarFunc result for job id A8MX19

User Input

>input (464 residues)
MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTSSKRPRLDPILADRSATAMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADMPQPAVRHEGREPLLVVKPTHSRPEGGCREV
PQAASKTHGLPQAARPQAQDKRPAVTSLPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.190	0.190	1.071E-57	464	0.914	0.914	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q8IXK0	0.063	0.039	1.106E-1	858	0.179	0.097	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
3	AFDB:O00268	0.077	0.041	3.299E-1	1085	0.211	0.090	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
4	AFDB:Q9QX47	0.067	0.018	4.642E-1	2444	0.175	0.033	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
5	AFDB:Q3U8K7	0.069	0.042	4.970E-1	883	0.157	0.083	Q3U8K7.pdb.gz	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
6	AFDB:Q766Z3	0.053	0.025	5.321E-1	1890	0.181	0.044	Q766Z3.pdb.gz	REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=REV3 PE=2 SV=1
7	AFDB:Q9VPZ7	0.052	0.024	6.100E-1	1342	0.162	0.056	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
8	AFDB:Q5JU85	0.051	0.023	8.584E-1	1488	0.159	0.050	Q5JU85.pdb.gz	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
9	AFDB:O15016	0.077	0.036	9.191E-1	1216	0.170	0.065	O15016.pdb.gz	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
10	AFDB:Q14814	0.056	0.051	9.191E-1	521	0.205	0.182	Q14814.pdb.gz	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1
11	PDB:6edtJ	0.067	0.217	1.013	109	0.019	0.083	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:3sucA	0.045	0.028	1.633	767	0.015	0.009	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
13	PDB:5hutA	0.040	0.040	1.633	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
14	PDB:7y9tA	0.052	0.063	2.005	380	0.015	0.018	7y9tA.pdb.gz
15	PDB:1p1fA	0.044	0.041	3.234	501	0.004	0.004	1p1fA.pdb.gz
16	PDB:4uhvB	0.041	0.031	3.234	645	0.037	0.026	4uhvB.pdb.gz
17	PDB:4v8mBj	0.061	0.160	3.234	161	0.019	0.056	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:7f5yB	0.047	0.155	3.234	120	0.006	0.025	7f5yB.pdb.gz
19	PDB:7mq8L8	0.038	0.097	3.234	180	0.009	0.022	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3zqjF	0.046	0.036	3.463	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	801	464	0.914	0.914	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
6	P04585	0.46	35.8	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
7	P03366	0.53	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
8	P04590	0.70	34.7	522	0.078	0.069	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
9	P05888	0.94	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.2	33.9	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.2	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	P70348	2.9	32.7	436	0.071	0.076	GCM1_MOUSE Chorion-specific transcription factor GCMa OS=Mus musculus OX=10090 GN=Gcm1 PE=1 SV=1
13	G5EF97	3.1	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
14	P12497	3.4	32.7	1435	0.056	0.018	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
15	Q8IZX4	3.6	32.7	1826	0.080	0.020	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
16	P35963	5.6	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
17	Q9BV36	6.3	32.0	600	0.039	0.030	MELPH_HUMAN Melanophilin OS=Homo sapiens OX=9606 GN=MLPH PE=1 SV=1
18	Q92830	6.5	32.0	837	0.045	0.025	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
19	Q9JHD2	6.5	32.0	830	0.045	0.025	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
20	D4ACX5	6.6	32.0	833	0.045	0.025	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14803 Nudix_N_2	5.1e+02	12.0	Nudix N-terminal
2	PF00098 zf-CCHC	1.1e+02	14.3	Zinc knuckle
3	PF15288 zf-CCHC_6	3.5e-19	79.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.416	catalytic activity
GO:0016740	0.358	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0019222	0.949	regulation of metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0031323	0.936	regulation of cellular metabolic process
GO:0019219	0.934	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.896	positive regulation of cellular process
GO:0051252	0.874	regulation of RNA metabolic process
GO:0010468	0.859	regulation of gene expression
GO:0009893	0.830	positive regulation of metabolic process
GO:0031325	0.814	positive regulation of cellular metabolic process
GO:0031326	0.806	regulation of cellular biosynthetic process
GO:0010556	0.805	regulation of macromolecule biosynthetic process
GO:0006355	0.800	regulation of DNA-templated transcription
GO:0010604	0.796	positive regulation of macromolecule metabolic process
GO:0051173	0.760	positive regulation of nitrogen compound metabolic process
GO:0045935	0.729	positive regulation of nucleobase-containing compound metabolic process
GO:0044260	0.653	cellular macromolecule metabolic process
GO:0031328	0.575	positive regulation of cellular biosynthetic process
GO:1903508	0.567	positive regulation of nucleic acid-templated transcription
GO:0045893	0.529	positive regulation of DNA-templated transcription
GO:0043412	0.455	macromolecule modification
GO:0034641	0.428	cellular nitrogen compound metabolic process
GO:1901564	0.407	organonitrogen compound metabolic process
GO:0019538	0.395	protein metabolic process
GO:0090304	0.386	nucleic acid metabolic process
GO:0036211	0.343	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043233	0.975	organelle lumen
GO:0005654	0.971	nucleoplasm
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0005694	0.929	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.358	Transferases.

[back to server]