StarFunc result for job id A8MXD5

User Input

>input (290 residues)
MLKREMKPESDRPRKVRFRIASSHSGRVLKEVYEDGQPSGSLDSECASICGIDGLGDSDG
QQNGHIESEGDENENDQDSLLVLARAASEKGFGTRRVNILSKNGTVRGVKYKVSAGQALF
NNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGE
YGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDILTKIERVQHPHECP
SCGGFGFLPCSVCHGSKMSMFRNCFTDSFKALKCTACNENGLQRCKNCAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MXD5	1.000	1.000	1.691E-58	290	1.000	1.000	A8MXD5.pdb.gz	GRCR1_HUMAN Glutaredoxin domain-containing cysteine-rich protein 1 OS=Homo sapiens OX=9606 GN=GRXCR1 PE=1 SV=1
2	AFDB:A0A140LFN7	0.543	0.534	7.570E-40	295	0.662	0.651	A0A140LFN7.pdb.gz
3	AFDB:A0A178UGU3	0.486	0.513	1.210E-17	274	0.286	0.303	A0A178UGU3.pdb.gz	A0A178UGU3_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At5g13810 PE=1 SV=1
4	AFDB:Q9FGG8	0.469	0.497	1.285E-15	273	0.241	0.256	Q9FGG8.pdb.gz	Q9FGG8_ARATH At5g58530 OS=Arabidopsis thaliana OX=3702 GN=MQJ2.15 PE=1 SV=1
5	AFDB:Q9LH89	0.474	0.326	1.765E-14	428	0.228	0.154	Q9LH89.pdb.gz	Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabidopsis thaliana OX=3702 GN=At3g28850 PE=4 SV=1
6	AFDB:Q9LZC2	0.488	0.371	2.006E-14	384	0.248	0.188	Q9LZC2.pdb.gz	Q9LZC2_ARATH Emb
7	PDB:4rqrA	0.302	0.740	1.813E-5	107	0.079	0.215	4rqrA.pdb.gz	Cysteine Specific Targeting of the Functionally Distinct Peroxiredoxin and Glutaredoxin Proteins by the Investigational Disulfide BNP7787.
8	AFDB:O82254	0.283	0.732	3.504E-5	103	0.069	0.194	O82254.pdb.gz	GRC12_ARATH Putative glutaredoxin-C12 OS=Arabidopsis thaliana OX=3702 GN=GRXC12 PE=3 SV=1
9	PDB:3qmxA	0.262	0.721	8.958E-5	99	0.076	0.222	3qmxA.pdb.gz
10	PDB:3uiwA	0.263	0.654	1.085E-4	110	0.069	0.182	3uiwA.pdb.gz	A New Mode of Iron-sulfur Cluster Coordination in Glutaredoxins is Crucial for Axonogenesis
11	PDB:3grxA	0.251	0.763	3.895E-4	82	0.076	0.268	3grxA.pdb.gz	NMR structure of Escherichia coli glutaredoxin 3-glutathione mixed disulfide complex: implications for the enzymatic mechanism.
12	PDB:1z7pA	0.280	0.641	4.153E-4	117	0.066	0.162	1z7pA.pdb.gz
13	PDB:4n11A	0.276	0.634	1.231E-3	108	0.059	0.157	4n11A.pdb.gz	Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
14	PDB:1ykaA	0.248	0.537	1.589E-3	115	0.062	0.157	1ykaA.pdb.gz
15	PDB:1wryA	0.289	0.652	2.486E-3	121	0.072	0.174	1wryA.pdb.gz
16	PDB:1grxA	0.211	0.558	3.011E-3	85	0.055	0.188	1grxA.pdb.gz	NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
17	AFDB:A0A1D8PPH3	0.273	0.094	3.072E-3	896	0.155	0.050	A0A1D8PPH3.pdb.gz	A0A1D8PPH3_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AIP5 PE=1 SV=1
18	PDB:2jadA	0.235	0.199	8.371E-3	346	0.062	0.052	2jadA.pdb.gz
19	AFDB:Q10MW6	0.192	0.111	2.227E-2	582	0.110	0.055	Q10MW6.pdb.gz	DJC27_ORYSJ DnaJ protein ERDJ3A OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ3A PE=1 SV=2
20	AFDB:B0BN02	0.202	0.141	3.959E-2	432	0.086	0.058	B0BN02.pdb.gz	B0BN02_RAT Metaxin 1 OS=Rattus norvegicus OX=10116 GN=Mtx1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MXD5	0.0	597	290	1.000	1.000	GRCR1_HUMAN Glutaredoxin domain-containing cysteine-rich protein 1 OS=Homo sapiens OX=9606 GN=GRXCR1 PE=1 SV=1
2	Q50H32	0.0	556	290	0.924	0.924	GRCR1_MOUSE Glutaredoxin domain-containing cysteine-rich protein 1 OS=Mus musculus OX=10090 GN=Grxcr1 PE=1 SV=1
3	Q3TYR5	1.52e-39	140	254	0.314	0.358	GRCR2_MOUSE Glutaredoxin domain-containing cysteine-rich protein 2 OS=Mus musculus OX=10090 GN=Grxcr2 PE=2 SV=1
4	A6NFK2	3.79e-32	121	248	0.307	0.359	GRCR2_HUMAN Glutaredoxin domain-containing cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=GRXCR2 PE=3 SV=1
5	A0A178UGU3	1.38e-29	115	274	0.245	0.259	A0A178UGU3_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At5g13810 PE=1 SV=1
6	Q9FGG8	8.48e-29	112	273	0.197	0.209	Q9FGG8_ARATH At5g58530 OS=Arabidopsis thaliana OX=3702 GN=MQJ2.15 PE=1 SV=1
7	Q9SGW5	6.15e-22	96.3	368	0.207	0.163	Q9SGW5_ARATH F1N19.7 OS=Arabidopsis thaliana OX=3702 GN=At1g64500 PE=1 SV=1
8	Q9LH89	1.48e-16	81.3	428	0.193	0.131	Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabidopsis thaliana OX=3702 GN=At3g28850 PE=4 SV=1
9	Q9LZC2	3.33e-16	80.1	384	0.190	0.143	Q9LZC2_ARATH Emb
10	Q8LBK6	1.72e-05	46.6	169	0.076	0.130	GRS15_ARATH Monothiol glutaredoxin-S15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GRXS15 PE=1 SV=2
11	Q9HDW8	1.81e-05	46.2	146	0.072	0.144	GLRX5_SCHPO Monothiol glutaredoxin-5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grx5 PE=1 SV=1
12	Q8H7F6	4.66e-05	46.6	293	0.079	0.078	GRS16_ARATH Bifunctional monothiol glutaredoxin-S16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GRXS16 PE=1 SV=2
13	Q02784	5.64e-04	42.0	150	0.072	0.140	GLRX5_YEAST Monothiol glutaredoxin-5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRX5 PE=1 SV=1
14	Q923X4	6.06e-04	42.0	156	0.069	0.128	GLRX2_MOUSE Glutaredoxin-2, mitochondrial OS=Mus musculus OX=10090 GN=Glrx2 PE=1 SV=1
15	Q9LIF1	7.61e-04	40.4	102	0.048	0.137	GRS10_ARATH Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana OX=3702 GN=GRXS10 PE=3 SV=1
16	O23419	7.76e-04	40.4	102	0.055	0.157	GRXS4_ARATH Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana OX=3702 GN=GRXS4 PE=3 SV=1
17	Q6NLU2	0.001	40.0	102	0.055	0.157	GRXS7_ARATH Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana OX=3702 GN=GRXS7 PE=1 SV=2
18	D4ADD7	0.002	40.8	214	0.110	0.150	D4ADD7_RAT Glutaredoxin 5 OS=Rattus norvegicus OX=10116 GN=Glrx5 PE=4 SV=2
19	Q6AXW1	0.002	40.0	157	0.059	0.108	GLRX2_RAT Glutaredoxin-2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Glrx2 PE=2 SV=2
20	Q8L8Z8	0.002	38.9	102	0.055	0.157	GRXS2_ARATH Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana OX=3702 GN=GRXS2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00462 Glutaredoxin	1.8e-05	36.2	Glutaredoxin
2	PF04908 SH3BGR	3.6e+02	12.7	SH3-binding, glutamic acid-rich protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340243	0.923	Serine incorporator 3
2	9606.ENSP00000371084	0.922	Phospholipid-transporting ATPase IA
3	9606.ENSP00000369314	0.818	Glutaredoxin-1
4	9606.ENSP00000319254	0.698	PDZ domain-containing protein GIPC3
5	9606.ENSP00000347839	0.680	Rab11 family-interacting protein 2
6	9606.ENSP00000387100	0.676	Taperin
7	9606.ENSP00000291532	0.653	Transmembrane protease serine 3
8	9606.ENSP00000384582	0.636	G-protein coupled receptor 98
9	9606.ENSP00000386647	0.632	Pejvakin
10	9606.ENSP00000367059	0.619	Espin
11	9606.ENSP00000280097	0.617	Histamine N-methyltransferase
12	9606.ENSP00000297784	0.613	Transmembrane channel-like protein 1
13	9606.ENSP00000471252	0.606	Ankyrin repeat domain-containing protein 24
14	9606.ENSP00000339115	0.588	Espin-like protein
15	9606.ENSP00000331065	0.575	Protein phosphatase 1 regulatory subunit 27
16	9606.ENSP00000357196	0.571	Receptor-type tyrosine-protein phosphatase kappa
17	9606.ENSP00000482885	0.571	Phosphatidylinositol phosphatase PTPRQ
18	9606.ENSP00000300591	0.570	Lipoxygenase homology domain-containing protein 1
19	9606.ENSP00000401513	0.566	Stereocilin
20	9606.ENSP00000477949	0.556	Transmembrane protease serine 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042490	0.995	mechanoreceptor differentiation
GO:0035315	0.995	hair cell differentiation
GO:0060119	0.994	inner ear receptor cell development
GO:0009653	0.983	anatomical structure morphogenesis
GO:0042491	0.961	inner ear auditory receptor cell differentiation
GO:0009887	0.900	animal organ morphogenesis
GO:0050954	0.791	sensory perception of mechanical stimulus
GO:0007605	0.745	sensory perception of sound
GO:0071840	0.456	cellular component organization or biogenesis
GO:0016043	0.428	cellular component organization
GO:0000902	0.423	cell morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005829	0.993	cytosol
GO:0120025	0.982	plasma membrane bounded cell projection
GO:0043229	0.799	intracellular organelle
GO:0098858	0.795	actin-based cell projection
GO:0043005	0.745	neuron projection
GO:0005929	0.719	cilium
GO:0032421	0.693	stereocilium bundle
GO:0097730	0.650	non-motile cilium
GO:0032420	0.581	stereocilium
GO:0043231	0.459	intracellular membrane-bounded organelle
GO:0071944	0.408	cell periphery
GO:0016020	0.380	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]