StarFunc result for job id A8MXE2

User Input

>input (369 residues)
MQVTFCRLRTHQWCFILFNVILFHALLFGTDFVEEYFLHSLPYIDVKVLEIKNKARKLNI
EPLRSNLSKYYVLSQSEICKGKNIFLLSLIFSSPGNGTRRDLIRKTWGNVTSVQGHPILT
LFALGMPVSVTTQKEINKESCKNNDIIEGIFLDSSENQTLKIIAMIQWAVAFCPNALFIL
KVDEETFVNLPSLVDYLLNLKEHLEDIYVGRVLHQVTPNRDPQNRDFVPLSEYPEKYYPD
YCSGEAFIMSQDVARMMYVVFKEVPMMVPADVFVGICAKFIGLIPIHSSRFSGKRHIRYN
RCCYKFIFTSSEIADPEMPLAWKEINDGKECTLFETSYELISCKLLTYLDSFKRFHMGTI
KNNLMYFAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYG0	0.683	0.668	1.210E-30	378	0.290	0.283	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
2	AFDB:Q99NB2	0.685	0.671	2.193E-30	377	0.293	0.286	Q99NB2.pdb.gz	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
3	AFDB:O96024	0.707	0.691	1.469E-29	378	0.282	0.275	O96024.pdb.gz	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
4	AFDB:Q9C0J1	0.667	0.652	1.015E-26	378	0.252	0.246	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
5	AFDB:Q6ZMB0	0.662	0.637	1.733E-26	384	0.252	0.242	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
6	AFDB:O75752	0.653	0.725	2.628E-26	331	0.249	0.278	O75752.pdb.gz	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
7	AFDB:Q9JI67	0.684	0.816	3.984E-26	308	0.257	0.308	Q9JI67.pdb.gz	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
8	AFDB:O43825	0.648	0.569	4.228E-26	422	0.220	0.192	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
9	AFDB:O54904	0.672	0.758	5.363E-26	326	0.247	0.279	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
10	AFDB:Q9Y2C3	0.682	0.808	5.691E-26	310	0.252	0.300	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
11	PDB:7jhiC	0.651	0.723	1.418E-23	331	0.203	0.227	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:6fxrA	0.353	0.209	1.237E-5	700	0.106	0.056	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4y63A	0.315	0.392	7.358E-5	282	0.076	0.099	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:1ll0B	0.260	0.335	2.721E-4	267	0.068	0.094	1ll0B.pdb.gz
15	PDB:7d72A	0.275	0.254	2.721E-4	407	0.087	0.079	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
16	PDB:2gamC	0.344	0.340	4.645E-4	374	0.079	0.078	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
17	PDB:5vcmB	0.273	0.280	7.042E-4	358	0.108	0.112	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
18	PDB:7x8kB	0.280	0.282	1.934E-3	367	0.079	0.079	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
19	PDB:1h5sB	0.287	0.345	2.932E-3	291	0.087	0.110	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
20	PDB:7f66J	0.298	0.212	2.932E-3	591	0.106	0.066	7f66J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BYG0	5.51e-49	171	378	0.260	0.254	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
2	Q99NB2	1.89e-47	167	377	0.276	0.271	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
3	O96024	1.86e-46	164	378	0.266	0.259	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
4	Q8BGY6	2.41e-46	164	376	0.274	0.269	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
5	Q9Y2C3	2.87e-40	146	310	0.241	0.287	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
6	Q9JI67	9.65e-39	142	308	0.230	0.276	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
7	Q9C0J1	1.95e-38	143	378	0.233	0.228	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
8	O54904	1.59e-37	139	326	0.211	0.239	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
9	Q9Y5Z6	1.59e-37	139	326	0.211	0.239	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
10	O54905	3.84e-37	140	422	0.214	0.187	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
11	O43825	1.37e-36	139	422	0.217	0.190	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	Q920V1	1.46e-36	137	331	0.257	0.287	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
13	O75752	1.76e-36	137	331	0.252	0.281	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
14	Q6ZMB0	5.73e-34	131	384	0.206	0.198	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
15	Q8NFL0	5.24e-31	123	401	0.217	0.200	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
16	Q8K0J2	7.03e-31	123	397	0.217	0.202	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
17	Q9Y2A9	5.42e-30	120	372	0.211	0.210	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
18	Q24157	7.92e-27	110	325	0.201	0.228	BRN_DROME Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2
19	Q9Z222	1.87e-26	110	397	0.182	0.169	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
20	Q9NY97	2.66e-26	110	397	0.168	0.156	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06837 Fijivirus_P9-2	6.5e+02	11.2	Fijivirus P9-2 protein
2	PF02434 Fringe	0.19	22.7	Fringe-like
3	PF01762 Galactosyl_T	2.8e-33	126.9	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005580984.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005581590.1	0.943	Beta-1,4-galactosyltransferase 1
2	9541.XP_005543664.1	0.926	Uncharacterized protein
3	9541.XP_005541262.1	0.923	Uncharacterized protein
4	9541.XP_005548130.1	0.910	Uncharacterized protein
5	9541.XP_005540347.1	0.900	Beta-1,3-galactosyltransferase 2
6	9541.XP_005548715.1	0.900	Hexosyltransferase
7	9541.XP_005573432.1	0.900	Hexosyltransferase
8	9541.XP_005587022.1	0.821	Beta-1,4-galactosyltransferase 6 isoform X1
9	9541.XP_005545588.1	0.803	Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans.
10	9541.XP_005595177.1	0.803	Beta-galactosidase-like
11	9541.XP_005546548.1	0.800	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
12	9541.XP_005575448.1	0.573	Uncharacterized protein
13	9541.XP_005580192.1	0.556	Belongs to the glycosyltransferase 29 family.
14	9541.XP_005568826.1	0.545	Microtubule-associated proteins 1A/1B light chain 3A isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035250	0.997	UDP-galactosyltransferase activity
GO:0048531	0.977	beta-1,3-galactosyltransferase activity
GO:0008499	0.847	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0008375	0.375	acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:1901566	0.983	organonitrogen compound biosynthetic process
GO:0044249	0.955	cellular biosynthetic process
GO:0009059	0.932	macromolecule biosynthetic process
GO:0070085	0.886	glycosylation
GO:0006486	0.879	protein glycosylation
GO:0005975	0.854	carbohydrate metabolic process
GO:0016051	0.842	carbohydrate biosynthetic process
GO:0009312	0.722	oligosaccharide biosynthetic process
GO:0044262	0.517	cellular carbohydrate metabolic process
GO:0034637	0.496	cellular carbohydrate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.996	Golgi membrane
GO:0005615	0.921	extracellular space
GO:0005783	0.321	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]