StarFunc result for job id A8MXK1

User Input

>input (200 residues)
MRPLPSGRRKTRGISLGLFALCLAAARCLQSQGVSLYIPQATINATVKEDILLSVEYSCH
GVPTIEWTYSSNWGTQKIVEWKPGTQANISQSHKDRVCTFDNGSIQLFSVGVRDSGYYVI
TVTERLGSSQFGTIVLHVSEILYEDLHFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRK
RRHKLKESTTEEIELEDVEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D806	0.869	0.873	1.735E-29	199	0.775	0.779	Q9D806.pdb.gz	VSTM5_MOUSE V-set and transmembrane domain-containing protein 5 OS=Mus musculus OX=10090 GN=Vstm5 PE=1 SV=1
2	AFDB:F8W2R4	0.588	0.275	1.842E-11	451	0.145	0.064	F8W2R4.pdb.gz
3	AFDB:Q7M729	0.523	0.464	2.434E-11	228	0.185	0.162	Q7M729.pdb.gz	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
4	AFDB:Q640R3	0.529	0.263	4.492E-11	418	0.185	0.089	Q640R3.pdb.gz	HECAM_MOUSE Hepatic and glial cell adhesion molecule OS=Mus musculus OX=10090 GN=Hepacam PE=1 SV=2
5	AFDB:Q8IWT1	0.524	0.465	1.447E-10	228	0.230	0.202	Q8IWT1.pdb.gz	SCN4B_HUMAN Sodium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=SCN4B PE=1 SV=1
6	AFDB:O60487	0.485	0.454	1.711E-10	215	0.210	0.195	O60487.pdb.gz	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
7	AFDB:P06907	0.505	0.421	1.912E-10	248	0.160	0.129	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
8	AFDB:P86176	0.493	0.402	2.138E-10	249	0.150	0.120	P86176.pdb.gz	TIGIT_MOUSE T-cell immunoreceptor with Ig and ITIM domains OS=Mus musculus OX=10090 GN=Tigit PE=3 SV=1
9	AFDB:Q6UWV2	0.504	0.435	2.527E-10	235	0.185	0.157	Q6UWV2.pdb.gz	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
10	AFDB:Q495A1	0.523	0.438	2.671E-10	244	0.205	0.168	Q495A1.pdb.gz	TIGIT_HUMAN T-cell immunoreceptor with Ig and ITIM domains OS=Homo sapiens OX=9606 GN=TIGIT PE=1 SV=1
11	PDB:3oaiA	0.469	0.201	5.320E-8	488	0.105	0.043	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:5ir3A	0.424	0.718	1.424E-6	111	0.080	0.144	5ir3A.pdb.gz
13	PDB:7qpdT	0.427	0.255	1.989E-6	348	0.090	0.052	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
14	PDB:5hhmI	0.425	0.433	2.779E-6	196	0.095	0.097	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
15	PDB:3o3uN	0.355	0.136	4.104E-6	580	0.105	0.036	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
16	PDB:4pfeA	0.432	0.264	6.776E-6	342	0.095	0.056	4pfeA.pdb.gz
17	PDB:5c6wJ	0.452	0.383	8.009E-6	238	0.115	0.097	5c6wJ.pdb.gz
18	PDB:3zhlA	0.426	0.658	1.119E-5	121	0.080	0.132	3zhlA.pdb.gz
19	PDB:6hd8A	0.407	0.190	1.119E-5	461	0.085	0.037	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
20	PDB:1bd2D	0.435	0.456	1.183E-5	190	0.085	0.089	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D806	1.35e-104	301	199	0.775	0.779	VSTM5_MOUSE V-set and transmembrane domain-containing protein 5 OS=Mus musculus OX=10090 GN=Vstm5 PE=1 SV=1
2	O88792	2.11e-04	43.1	300	0.175	0.117	JAM1_MOUSE Junctional adhesion molecule A OS=Mus musculus OX=10090 GN=F11r PE=1 SV=2
3	Q640R3	2.36e-04	43.5	418	0.170	0.081	HECAM_MOUSE Hepatic and glial cell adhesion molecule OS=Mus musculus OX=10090 GN=Hepacam PE=1 SV=2
4	Q14CZ8	2.61e-04	43.1	416	0.180	0.087	HECAM_HUMAN Hepatic and glial cell adhesion molecule OS=Homo sapiens OX=9606 GN=HEPACAM PE=1 SV=1
5	Q9JHY1	0.001	40.8	300	0.170	0.113	JAM1_RAT Junctional adhesion molecule A OS=Rattus norvegicus OX=10116 GN=F11r PE=1 SV=1
6	Q53CM6	0.023	37.7	2024	0.140	0.014	Q53CM6_DANRE Down syndrome cell adhesion molecule OS=Danio rerio OX=7955 GN=dscam PE=2 SV=1
7	Q6WRH9	0.028	37.4	2597	0.175	0.013	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
8	Q810J1	0.045	36.6	475	0.160	0.067	PSG22_MOUSE Pregnancy-specific glycoprotein 22 OS=Mus musculus OX=10090 GN=Psg22 PE=1 SV=2
9	Q502A9	0.046	36.6	422	0.105	0.050	Q502A9_DANRE Hepatic and glial cell adhesion molecule a precursor OS=Danio rerio OX=7955 GN=zgc:112363 PE=2 SV=1
10	A2AJ76	0.071	36.2	5100	0.130	0.005	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
11	F1NY98	0.082	35.8	2034	0.190	0.019	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
12	Q6GU68	0.11	35.4	428	0.160	0.075	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
13	Q6AWJ9	0.14	35.0	1033	0.145	0.028	PTK7_DROME Tyrosine-protein kinase-like otk OS=Drosophila melanogaster OX=7227 GN=otk PE=1 SV=1
14	Q925P2	0.27	34.3	520	0.140	0.054	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
15	D3YXQ6	0.30	33.9	262	0.120	0.092	D3YXQ6_MOUSE Pregnancy specific beta-1-glycoprotein 16 (Fragment) OS=Mus musculus OX=10090 GN=Psg16 PE=4 SV=1
16	Q7Z692	0.30	33.9	300	0.150	0.100	CEA19_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 19 OS=Homo sapiens OX=9606 GN=CEACAM19 PE=2 SV=2
17	O60469	0.33	34.3	2012	0.170	0.017	DSCAM_HUMAN Cell adhesion molecule DSCAM OS=Homo sapiens OX=9606 GN=DSCAM PE=1 SV=2
18	Q8VHZ8	0.35	33.9	2013	0.170	0.017	DSCAM_RAT Cell adhesion molecule DSCAM OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1
19	Q9ERC8	0.35	33.9	2013	0.170	0.017	DSCAM_MOUSE Cell adhesion molecule DSCAM OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1
20	Q13308	0.37	33.9	1070	0.185	0.035	PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	4.6	18.7	Immunoglobulin I-set domain
2	PF13927 Ig_3	35	16.4	Immunoglobulin domain
3	PF11465 Receptor_2B4	0.7	21.5	Natural killer cell receptor 2B4
4	PF07686 V-set	0.16	23.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331209	0.728	Ester hydrolase C11orf54
2	9606.ENSP00000298966	0.675	Single-pass membrane protein with coiled-coil domains 4
3	9606.ENSP00000364220	0.641	Von Willebrand factor A domain containing 5B1
4	9606.ENSP00000251871	0.631	Mediator of RNA polymerase II transcription subunit 17
5	9606.ENSP00000243673	0.627	Probable G-protein coupled receptor 83
6	9606.ENSP00000327801	0.601	Protein disulfide-isomerase
7	9606.ENSP00000313699	0.594	Hephaestin-like protein 1
8	9606.ENSP00000356143	0.549	Leucine rich repeat neuronal 2
9	9606.ENSP00000371577	0.529	Myotubularin-related protein 12
10	9606.ENSP00000397312	0.520	Leucine-rich repeat neuronal protein 3
11	9606.ENSP00000453076	0.516	G-protein coupled receptor 176
12	9606.ENSP00000269503	0.501	Cerebellin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0032501	0.946	multicellular organismal process
GO:0048518	0.901	positive regulation of biological process
GO:0048522	0.819	positive regulation of cellular process
GO:0048856	0.772	anatomical structure development
GO:0051239	0.618	regulation of multicellular organismal process
GO:0007275	0.561	multicellular organism development
GO:0071840	0.559	cellular component organization or biogenesis
GO:0016043	0.433	cellular component organization
GO:0051128	0.385	regulation of cellular component organization
GO:0044085	0.384	cellular component biogenesis
GO:0048731	0.378	system development
GO:0007399	0.374	nervous system development
GO:0065008	0.370	regulation of biological quality
GO:0022607	0.361	cellular component assembly
GO:0051240	0.351	positive regulation of multicellular organismal process
GO:0007417	0.331	central nervous system development
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0120025	0.973	plasma membrane bounded cell projection
GO:0043005	0.803	neuron projection
GO:0043229	0.735	intracellular organelle
GO:0043227	0.709	membrane-bounded organelle
GO:0030424	0.585	axon
GO:0036477	0.529	somatodendritic compartment
GO:0097447	0.512	dendritic tree
GO:0030425	0.496	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]