StarFunc result for job id A8MXQ7

User Input

>input (560 residues)
MDSKKGRPKAAAGKWQTLHPGPKTRAAAGKPGENRPPQRKAGWQAREPASAESPQAPTGP
AEDRAARAIQGAFRQLRARRELARRREERREYLEQMETPQKEAYLAPVRREQEAARRLRE
QEEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVEQLLTREGVGHDEAGEARRLQR
RVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFGGHLAA
VEVLLKLGADPRVYAEDGSTPERVASLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRAQEA
QRHKEAEAERCGSMTLKVQQLTREQQQCHKELQQAYCELSRRISEHDQCEWRCMDKTKLT
LQAIKDTEAQVDRLRQEAQKAEEALAMARLELREQTQEGEEEAPGLKCQVTELHDVLMKD
VGNRIRADGRWPLVIDPLGQAATFLRYQDTNYVDTVNPEPLRPETMWLALLGALRYGKPL
VFDLREEDLFPVVQRQLEAVQERYLSLLRPTDGPEYSPTQFQEQRLEHFRLFFVTKVQWP
PAEQLQVLLPVRVQLPGTGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C5C7	0.171	0.197	6.712E-9	481	0.118	0.137	Q9C5C7.pdb.gz	Q9C5C7_ARATH AAA-type ATPase family protein / ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24530 PE=1 SV=1
2	AFDB:M9NFF9	0.189	0.182	1.155E-6	583	0.079	0.075	M9NFF9.pdb.gz	M9NFF9_DROME Ada2a-containing complex component 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Atac3 PE=4 SV=1
3	AFDB:Q9VBP3	0.192	0.096	1.408E-6	1181	0.070	0.033	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
4	AFDB:Q55FM5	0.203	0.889	1.895E-6	120	0.055	0.258	Q55FM5.pdb.gz	MTPN_DICDI Myotrophin homolog OS=Dictyostelium discoideum OX=44689 GN=mtpn PE=3 SV=1
5	AFDB:Q8TAK5	0.178	0.216	1.992E-6	448	0.070	0.087	Q8TAK5.pdb.gz	GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens OX=9606 GN=GABPB2 PE=1 SV=1
6	AFDB:Q06547	0.185	0.255	2.093E-6	395	0.066	0.094	Q06547.pdb.gz	GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=2
7	AFDB:Q6UB98	0.195	0.054	2.199E-6	2062	0.061	0.016	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
8	AFDB:G9BZS8	0.190	0.859	2.428E-6	118	0.059	0.280	G9BZS8.pdb.gz	G9BZS8_PIG Myotrophin OS=Sus scrofa OX=9823 GN=MTPN PE=2 SV=1
9	AFDB:A0A140LI88	0.198	0.062	2.680E-6	1857	0.102	0.031	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
10	AFDB:P81069	0.177	0.232	2.959E-6	414	0.073	0.099	P81069.pdb.gz	GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus OX=10090 GN=Gabpb2 PE=1 SV=2
11	PDB:3ehqA	0.196	0.578	3.586E-5	182	0.054	0.165	3ehqA.pdb.gz
12	PDB:8cs9A	0.171	0.125	5.884E-5	796	0.082	0.058	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:2dvwA	0.182	0.415	6.826E-5	229	0.062	0.153	2dvwA.pdb.gz
14	PDB:1wg0A	0.157	0.354	1.014E-4	243	0.050	0.115	1wg0A.pdb.gz
15	PDB:6mwqA	0.195	0.220	1.177E-4	493	0.079	0.089	6mwqA.pdb.gz
16	PDB:5vkqA	0.184	0.074	1.236E-4	1499	0.075	0.028	5vkqA.pdb.gz
17	PDB:6jd6B	0.188	0.494	1.434E-4	192	0.070	0.203	6jd6B.pdb.gz
18	PDB:7df7B	0.194	0.867	1.507E-4	119	0.057	0.269	7df7B.pdb.gz
19	PDB:5nugA	0.154	0.038	1.930E-4	2920	0.127	0.024	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
20	PDB:7z8gA	0.155	0.043	1.930E-4	3047	0.086	0.016	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8MQG0	1.60e-09	63.5	1841	0.082	0.025	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
2	G5ECZ1	1.64e-09	63.5	1867	0.082	0.025	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
3	Q17490	2.46e-09	63.2	6994	0.082	0.007	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
4	A8JNM4	6.43e-09	61.6	2532	0.077	0.017	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
5	Q7KU95	6.45e-09	61.6	2404	0.077	0.018	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	X2JGD3	6.67e-09	61.6	2566	0.077	0.017	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	M9MS19	8.02e-09	61.2	4230	0.077	0.010	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	M9PEN3	8.24e-09	61.2	4373	0.077	0.010	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	M9MRR4	8.37e-09	61.2	4223	0.077	0.010	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	Q7KU92	8.71e-09	61.2	4083	0.077	0.011	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
11	M9MRX1	8.82e-09	61.2	4329	0.077	0.010	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	X2JC49	8.96e-09	61.2	4233	0.077	0.010	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	A8JNM6	9.03e-09	61.2	4189	0.077	0.010	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	M9MSK6	9.13e-09	61.2	4352	0.077	0.010	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	A8JNM7	9.18e-09	61.2	4114	0.077	0.010	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	A8JNM5	9.20e-09	61.2	4264	0.077	0.010	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9PBV0	1.20e-08	60.1	547	0.077	0.079	M9PBV0_DROME Ankyrin 2, isoform X OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	Q3KN55	1.46e-08	60.1	697	0.077	0.062	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	Q9NCP8	1.91e-08	59.7	1159	0.077	0.037	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9PHP8	2.05e-08	59.7	1309	0.077	0.033	M9PHP8_DROME Ankyrin 2, isoform W OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12781 AAA_9	0.024	25.3	ATP-binding dynein motor region
2	PF00023 Ank	5.4	18.8	Ankyrin repeat
3	PF12796 Ank_2	0.1	24.5	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	0.88	21.2	Ankyrin repeat
5	PF13637 Ank_4	3.4	19.6	Ankyrin repeats (many copies)
6	PF13857 Ank_5	0.022	26.3	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005564519.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005571928.1	0.544	Caspase and RIP adapter
2	9541.XP_005563585.1	0.516	Telomeric repeat-binding factor 1 isoform X1
3	9541.XP_005560731.1	0.508	Telomerase protein component 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.988	biological regulation
GO:0050794	0.975	regulation of cellular process
GO:0048519	0.767	negative regulation of biological process
GO:0050896	0.754	response to stimulus
GO:0019222	0.736	regulation of metabolic process
GO:0008152	0.723	metabolic process
GO:0048523	0.708	negative regulation of cellular process
GO:0071840	0.680	cellular component organization or biogenesis
GO:0048518	0.656	positive regulation of biological process
GO:0044237	0.654	cellular metabolic process
GO:0016043	0.652	cellular component organization
GO:0080090	0.643	regulation of primary metabolic process
GO:0060255	0.629	regulation of macromolecule metabolic process
GO:0048522	0.623	positive regulation of cellular process
GO:0051171	0.591	regulation of nitrogen compound metabolic process
GO:0031323	0.578	regulation of cellular metabolic process
GO:0071704	0.547	organic substance metabolic process
GO:0006996	0.496	organelle organization
GO:0044238	0.483	primary metabolic process
GO:0006807	0.417	nitrogen compound metabolic process
GO:0065009	0.401	regulation of molecular function
GO:0065008	0.394	regulation of biological quality
GO:0043170	0.381	macromolecule metabolic process
GO:0042592	0.371	homeostatic process
GO:0006725	0.352	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.986	nucleus
GO:0031974	0.962	membrane-enclosed lumen
GO:0070013	0.939	intracellular organelle lumen
GO:0031981	0.889	nuclear lumen
GO:0005829	0.714	cytosol
GO:0043232	0.313	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]