StarFunc result for job id A8MXZ1

User Input

>input (464 residues)
MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRSPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREV
PQAASKTHGLLQAARPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.371	0.371	5.486E-57	464	0.925	0.925	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q6FUW3	0.067	0.037	1.497E-1	975	0.140	0.067	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
3	AFDB:Q9QWH1	0.059	0.039	7.061E-1	850	0.181	0.099	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
4	AFDB:Q8IXK0	0.066	0.040	7.554E-1	858	0.175	0.094	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
5	PDB:6edtJ	0.064	0.220	8.808E-1	109	0.019	0.083	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
6	AFDB:P33749	0.083	0.066	1.132	630	0.157	0.116	P33749.pdb.gz	MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSN4 PE=1 SV=1
7	AFDB:A0A1D5NXF3	0.067	0.046	1.295	732	0.175	0.111	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
8	AFDB:A0A024RDC4	0.069	0.052	1.386	689	0.185	0.125	A0A024RDC4.pdb.gz
9	AFDB:Q92953	0.069	0.041	1.386	911	0.168	0.086	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
10	AFDB:A0A0A0MSI2	0.056	0.035	1.586	830	0.149	0.083	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
11	AFDB:A0A1D5PRD7	0.075	0.050	1.815	772	0.147	0.088	A0A1D5PRD7.pdb.gz	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
12	PDB:5hutA	0.040	0.040	1.849	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
13	PDB:3zqjF	0.046	0.036	2.116	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
14	PDB:4v8mBj	0.064	0.167	2.772	161	0.019	0.056	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:6i9ra	0.058	0.248	2.772	83	0.013	0.072	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
16	PDB:7y9tA	0.052	0.063	3.393	380	0.015	0.018	7y9tA.pdb.gz
17	PDB:3sucA	0.045	0.028	3.630	767	0.011	0.007	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
18	PDB:6yxyBA	0.034	0.021	3.630	769	0.028	0.017	6yxyBA.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7mq8L8	0.038	0.097	3.630	180	0.013	0.033	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:8escS	0.071	0.103	4.154	268	0.022	0.037	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	810	464	0.925	0.925	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
6	P04585	0.52	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
7	P03366	0.58	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
8	P04590	0.77	34.7	522	0.045	0.040	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
9	P05888	0.95	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.2	33.9	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.2	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	G5EF97	3.0	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
13	P12497	3.8	32.7	1435	0.056	0.018	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
14	Q8IZX4	5.2	32.3	1826	0.082	0.021	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
15	D4ACX5	5.3	32.0	833	0.045	0.025	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
16	Q92830	5.4	32.0	837	0.045	0.025	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
17	Q9JHD2	5.6	32.0	830	0.045	0.025	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
18	P35963	5.9	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
19	A0A8I6A7M0	9.4	31.6	1893	0.024	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
20	Q80UV9	9.4	31.6	1891	0.024	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1.1e+02	14.4	Zinc knuckle
2	PF15288 zf-CCHC_6	3.5e-19	79.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.442	catalytic activity
GO:0016740	0.412	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0044237	0.981	cellular metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0019222	0.967	regulation of metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0048522	0.925	positive regulation of cellular process
GO:0080090	0.919	regulation of primary metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0051171	0.919	regulation of nitrogen compound metabolic process
GO:0009893	0.878	positive regulation of metabolic process
GO:0043170	0.874	macromolecule metabolic process
GO:0019219	0.859	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.846	positive regulation of cellular metabolic process
GO:0051252	0.775	regulation of RNA metabolic process
GO:0010604	0.768	positive regulation of macromolecule metabolic process
GO:0051173	0.745	positive regulation of nitrogen compound metabolic process
GO:0010468	0.741	regulation of gene expression
GO:0031326	0.723	regulation of cellular biosynthetic process
GO:0010556	0.722	regulation of macromolecule biosynthetic process
GO:0006355	0.706	regulation of DNA-templated transcription
GO:0044260	0.647	cellular macromolecule metabolic process
GO:0045935	0.645	positive regulation of nucleobase-containing compound metabolic process
GO:0034641	0.489	cellular nitrogen compound metabolic process
GO:0006139	0.480	nucleobase-containing compound metabolic process
GO:1903508	0.476	positive regulation of nucleic acid-templated transcription
GO:0019538	0.467	protein metabolic process
GO:0043412	0.466	macromolecule modification
GO:0045893	0.453	positive regulation of DNA-templated transcription
GO:0090304	0.379	nucleic acid metabolic process
GO:0036211	0.353	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.982	nucleoplasm
GO:0005694	0.957	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.412	Transferases.

[back to server]