StarFunc result for job id A8MYP8

User Input

>input (253 residues)
MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNTGYALHDPSRPRAPAFTFGARFPTQ
QTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSA
PRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIGKVSAPTCSIYGRRAAGSFFEDLSK
TPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPRGWSFGIRH
SDYLAPLVTDADN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MYP8	1.000	1.000	5.251E-40	253	1.000	1.000	A8MYP8.pdb.gz	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1
2	AFDB:Q920N1	0.184	0.183	1.801E-17	254	0.470	0.469	Q920N1.pdb.gz	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
3	PDB:7a5f93	0.114	0.186	6.024	109	0.075	0.174	7a5f93.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
4	PDB:6i9r9	0.079	0.124	9.933	124	0.079	0.161	6i9r9.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MYP8	0.0	507	253	1.000	1.000	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1
2	Q920N1	1.52e-72	224	254	0.474	0.472	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
3	Q96PU9	4.66e-70	217	254	0.462	0.461	CMA1A_HUMAN Ciliary microtubule associated protein 1A OS=Homo sapiens OX=9606 GN=CIMAP1A PE=1 SV=1
4	B3DI43	1.61e-44	152	252	0.375	0.377	B3DI43_DANRE Outer dense fiber of sperm tails 3-like 2b OS=Danio rerio OX=7955 GN=cimap1d PE=2 SV=1
5	Q8IXM7	5.13e-26	104	274	0.308	0.285	CMA1C_HUMAN Protein CIMAP1C OS=Homo sapiens OX=9606 GN=CIMAP1C PE=1 SV=1
6	Q3SX64	1.26e-25	103	289	0.308	0.270	CMA1D_HUMAN Protein CIMAP1D OS=Homo sapiens OX=9606 GN=CIMAP1D PE=1 SV=2
7	M9PCD3	9.39e-21	90.1	261	0.312	0.303	M9PCD3_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
8	Q9VLQ4	3.38e-20	89.0	272	0.304	0.283	Q9VLQ4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=2
9	Q8IPG0	5.76e-20	89.0	298	0.304	0.258	Q8IPG0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=1
10	M9PB71	1.02e-14	75.9	1603	0.296	0.047	M9PB71_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
11	M9NEC3	1.19e-11	66.6	1568	0.261	0.042	M9NEC3_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
12	M9NCS7	4.53e-10	62.0	1569	0.269	0.043	M9NCS7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
13	M9PF71	4.86e-10	62.0	1516	0.269	0.045	M9PF71_DROME Uncharacterized protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
14	M9PB72	3.57e-09	59.3	1501	0.182	0.031	M9PB72_DROME Uncharacterized protein, isoform P OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
15	M9PCX6	3.58e-09	59.3	1448	0.182	0.032	M9PCX6_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
16	Q7KTI5	3.61e-09	59.3	1534	0.182	0.030	Q7KTI5_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=3
17	M9PCJ4	3.81e-09	59.3	1512	0.182	0.030	M9PCJ4_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
18	Q7KTI6	3.90e-09	58.9	1453	0.182	0.032	Q7KTI6_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=3
19	Q961P7	7.57e-04	42.7	426	0.206	0.122	Q961P7_DROME GH11964p OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=2 SV=1
20	Q57XU0	0.021	38.5	2395	0.170	0.018	Q57XU0_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.130 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	2.4e-09	48.8	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333374	0.631	Coiled-coil domain containing 60
2	9606.ENSP00000402152	0.627	Solute carrier family 12 member 3
3	9606.ENSP00000424381	0.581	Lipase maturation factor 2
4	9606.ENSP00000219299	0.548	Coiled-coil domain-containing protein 113
5	9606.ENSP00000376872	0.547	Rab-like protein 2A
6	9606.ENSP00000390932	0.533	Leucine-rich repeat-containing protein 23
7	9606.ENSP00000295268	0.520	Sperm-tail PG-rich repeat-containing protein 2
8	9606.ENSP00000379038	0.513	Thymidine phosphorylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.949	multicellular organismal process
GO:0009987	0.851	cellular process
GO:0003008	0.731	system process
GO:0050877	0.503	nervous system process
GO:0007600	0.474	sensory perception
GO:0065007	0.467	biological regulation
GO:0050789	0.435	regulation of biological process
GO:0007605	0.418	sensory perception of sound
GO:0050794	0.359	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0099512	0.995	supramolecular fiber
GO:0005737	0.993	cytoplasm
GO:0005856	0.989	cytoskeleton
GO:0099513	0.982	polymeric cytoskeletal fiber
GO:0016020	0.938	membrane
GO:0120025	0.906	plasma membrane bounded cell projection
GO:0005929	0.841	cilium
GO:0036126	0.751	sperm flagellum
GO:0001520	0.670	outer dense fiber
GO:0043231	0.569	intracellular membrane-bounded organelle
GO:0071944	0.380	cell periphery
GO:0005634	0.320	nucleus
GO:0032991	0.319	protein-containing complex
GO:0005886	0.300	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]