StarFunc result for job id A8MYU2

User Input

>input (1149 residues)
MFQTKLRNETWEDLPKMSCTTEIQAAFILSSFVTFFSGLIILLIFRLIWRSVKKWQIIKG
TGIILELFTSGTIARSHVRSLHFQGQFRDHIEMLLSAQTFVGQVLVILVFVLSIGSLIIY
FINSADPVGSCSSYEDKTIPIDLVFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILRAIKTSNSVKFSKLLSIILSTWFTAAG
FIHLVENSGDPWLKGRNSQNISYFESIYLVMATTSTVGFGDVVAKTSLGRTFIMFFTLGS
LILFANYIPEMVELFANKRKYTSSYEALKGKKFIVVCGNITVDSVTAFLRNFLRDKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSAMKWEDLRRVAVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHNKVYLPKIPSWNWDTGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVMPKQTWKKHFLNSMKNKILTQRLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNPPPQVRIRKNTLGFFIAETPKDVRRAL
FYCSVCHDDVFIPELITNCGCKSRSRQHITVPSVKRMKKCLKGISSRISGQDSPPRVSAS
TSSISNFTTRTLQHDVEQDSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACV
FGDAHSAPMGLRNFVMPLRASNYTRKELKDIVFIGSLDYLQREWRFLWNFPQIYILPGCA
LYSGDLHAANIEQCSMCAVLSPPPQPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPSVS
EETPGYTNGHNEKSNCRKVPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNR
CKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITR
PANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDS
VTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDE
DPFAYSEPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MYU2	1.000	1.000	0.000	1149	1.000	1.000	A8MYU2.pdb.gz	KCNU1_HUMAN Potassium channel subfamily U member 1 OS=Homo sapiens OX=9606 GN=KCNU1 PE=1 SV=2
2	AFDB:O54982	0.855	0.876	0.000	1121	0.633	0.649	O54982.pdb.gz	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
3	AFDB:Q28204	0.783	0.773	1.399E-99	1166	0.422	0.416	Q28204.pdb.gz	KCMA1_BOVIN Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2
4	AFDB:A0A2R8QRZ7	0.780	0.732	5.202E-99	1229	0.426	0.399	A0A2R8QRZ7.pdb.gz	A0A2R8QRZ7_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=1
5	AFDB:Q12791	0.778	0.725	1.604E-98	1236	0.414	0.385	Q12791.pdb.gz	KCMA1_HUMAN Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens OX=9606 GN=KCNMA1 PE=1 SV=2
6	AFDB:Q08460	0.782	0.744	3.731E-98	1209	0.421	0.400	Q08460.pdb.gz	KCMA1_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=2
7	AFDB:Q03720	0.759	0.728	6.133E-93	1200	0.385	0.368	Q03720.pdb.gz	SLO_DROME Calcium-activated potassium channel slowpoke OS=Drosophila melanogaster OX=7227 GN=slo PE=1 SV=3
8	AFDB:H7BRM5	0.777	0.797	9.766E-92	1118	0.365	0.375	H7BRM5.pdb.gz	H7BRM5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
9	AFDB:H8ESD6	0.779	0.781	1.124E-91	1146	0.364	0.365	H8ESD6.pdb.gz	H8ESD6_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
10	AFDB:H7BRC9	0.772	0.765	2.272E-91	1160	0.369	0.366	H7BRC9.pdb.gz	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
11	PDB:7pxeA	0.717	0.922	1.778E-81	885	0.346	0.450	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
12	PDB:6u68A	0.170	0.535	1.499E-12	319	0.061	0.219	6u68A.pdb.gz
13	PDB:3rbzA	0.195	0.634	3.802E-10	289	0.057	0.225	3rbzA.pdb.gz	Structures of multiple Ca2+-binding sites in a K+ channel RCK domain
14	PDB:4j7cB	0.108	0.455	1.609E-6	217	0.039	0.207	4j7cB.pdb.gz	The structure of the KtrAB potassium transporter
15	PDB:7wswA	0.161	0.339	6.864E-5	472	0.067	0.163	7wswA.pdb.gz
16	PDB:7f3fA	0.106	0.232	3.716E-4	460	0.047	0.117	7f3fA.pdb.gz
17	PDB:7sizB	0.110	0.320	8.249E-4	334	0.049	0.168	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
18	PDB:7bylA	0.098	0.259	9.496E-4	354	0.038	0.124	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
19	PDB:7phhA	0.118	0.287	1.258E-3	396	0.037	0.106	7phhA.pdb.gz
20	PDB:7w6sB	0.107	0.243	1.518E-3	448	0.046	0.118	7w6sB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QRZ7	903	1229	0.419	0.391	A0A2R8QRZ7_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=1
2	A8MYU2	2373	1149	1.000	1.000	KCNU1_HUMAN Potassium channel subfamily U member 1 OS=Homo sapiens OX=9606 GN=KCNU1 PE=1 SV=2
3	B7ZC96	913	1184	0.417	0.405	KCMA1_DANRE Calcium-activated potassium channel subunit alpha-1a OS=Danio rerio OX=7955 GN=kcnma1a PE=1 SV=1
4	C3VLD3	897	1195	0.414	0.398	C3VLD3_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=1
5	F1QYL4	910	1205	0.417	0.398	F1QYL4_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=3
6	H7BRC9	715	1160	0.368	0.365	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
7	H7BRM4	716	1153	0.367	0.366	H7BRM4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
8	H7BRM5	726	1118	0.365	0.375	H7BRM5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
9	H7BRM7	711	1131	0.362	0.368	H7BRM7_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
10	H8ESD6	707	1146	0.355	0.356	H8ESD6_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
11	H8ESD8	711	1138	0.363	0.366	H8ESD8_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
12	H8ESE2	707	1160	0.366	0.362	H8ESE2_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
13	H8ESE3	709	1153	0.365	0.363	H8ESE3_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
14	H8ESE4	718	1138	0.366	0.369	H8ESE4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
15	H8ESE5	721	1140	0.367	0.370	H8ESE5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
16	O18866	907	1152	0.415	0.414	KCMA1_PIG Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2
17	O54982	1428	1121	0.634	0.650	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
18	Q08460	896	1209	0.414	0.394	KCMA1_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=2
19	Q12791	897	1236	0.417	0.388	KCMA1_HUMAN Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens OX=9606 GN=KCNMA1 PE=1 SV=2
20	Q28204	907	1166	0.415	0.409	KCMA1_BOVIN Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03493 BK_channel_a	7.1e-25	98.6	Calcium-activated BK potassium channel alpha subunit
2	PF20313 DUF6609	27	16.2	Family of unknown function (DUF6609)
3	PF00520 Ion_trans	1.7e-12	58.7	Ion transport protein
4	PF07885 Ion_trans_2	2.2e-08	45.3	Ion channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258111	0.927	Calcium-activated potassium channel subunit beta-4
2	9606.ENSP00000476519	0.921	Small conductance calcium-activated potassium channel protein 1
3	9606.ENSP00000274629	0.915	Calcium-activated potassium channel subunit beta-1
4	9606.ENSP00000427120	0.911	Small conductance calcium-activated potassium channel protein 2
5	9606.ENSP00000262888	0.907	Intermediate conductance calcium-activated potassium channel protein 4
6	9606.ENSP00000319370	0.903	Calcium-activated potassium channel subunit beta-3
7	9606.ENSP00000481848	0.895	Small conductance calcium-activated potassium channel protein 3
8	9606.ENSP00000294818	0.884	Leucine-rich repeat-containing protein 52
9	9606.ENSP00000407592	0.848	Potassium large conductance calcium-activated channel, subfamily M, beta member 2
10	9606.ENSP00000286628	0.814	Calcium-activated potassium channel subunit alpha-1
11	9606.ENSP00000363092	0.813	cGMP-dependent protein kinase 1
12	9606.ENSP00000419542	0.763	Leucine-rich repeat-containing protein 55
13	9606.ENSP00000365253	0.742	Leucine-rich repeat-containing protein 38
14	9606.ENSP00000360597	0.730	Leucine-rich repeat-containing protein 26
15	9606.ENSP00000309052	0.726	Cation channel sperm-associated protein 1
16	9606.ENSP00000332325	0.704	Zinc finger protein 703
17	9606.ENSP00000266376	0.703	Voltage-dependent L-type calcium channel subunit alpha-1C
18	9606.ENSP00000288139	0.680	Voltage-dependent L-type calcium channel subunit alpha-1D
19	9606.ENSP00000309591	0.680	cAMP-dependent protein kinase catalytic subunit alpha
20	9606.ENSP00000359719	0.680	cAMP-dependent protein kinase catalytic subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005267	1.000	potassium channel activity
GO:0022843	0.996	voltage-gated monoatomic cation channel activity
GO:0005249	0.990	voltage-gated potassium channel activity
GO:0015269	0.983	calcium-activated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006811	0.995	monoatomic ion transport
GO:0030001	0.994	metal ion transport
GO:0065007	0.992	biological regulation
GO:0009987	0.990	cellular process
GO:0006813	0.977	potassium ion transport
GO:0050789	0.922	regulation of biological process
GO:0065008	0.858	regulation of biological quality
GO:0050794	0.701	regulation of cellular process
GO:0050896	0.604	response to stimulus
GO:0031647	0.499	regulation of protein stability
GO:0050821	0.356	protein stabilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043232	0.751	intracellular non-membrane-bounded organelle
GO:0005737	0.553	cytoplasm
GO:0030054	0.348	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]