StarFunc result for job id A8MYZ6

User Input

>input (492 residues)
MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRAT
APAMAPAPPLGAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVR
YVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRR
RAVSMDNGAKFLRIKGKASKKKQLQAPERSPDDSSPSAPAPGPVPAAAKWAASPASHASD
DYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYPSPASALSPALGSRCPGELPR
LAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRPAPRPGPVLGAPGELALAGAAAAYPGK
GAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPPGHAAAFGGPPGGLLLDALPGPYAA
AAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALPPPPPGLA
GAPPPNQSWVPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MYZ6	0.999	0.999	2.980E-72	492	1.000	1.000	A8MYZ6.pdb.gz	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
2	AFDB:Q70KY4	0.202	0.180	3.620E-59	559	0.961	0.846	Q70KY4.pdb.gz	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
3	AFDB:D4A433	0.273	0.266	7.386E-29	505	0.415	0.404	D4A433.pdb.gz	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
4	AFDB:O54743	0.156	0.172	5.703E-11	446	0.205	0.226	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
5	AFDB:Q9DE24	0.158	0.177	1.303E-10	433	0.205	0.233	Q9DE24.pdb.gz	FXC1B_DANRE Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b PE=2 SV=1
6	AFDB:Q91765	0.167	0.187	2.460E-10	434	0.161	0.182	Q91765.pdb.gz	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
7	AFDB:E7EZ33	0.181	0.247	2.794E-10	348	0.152	0.216	E7EZ33.pdb.gz
8	AFDB:O60548	0.156	0.155	3.839E-10	495	0.232	0.230	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
9	AFDB:Q3SYB3	0.164	0.192	2.136E-9	417	0.207	0.245	Q3SYB3.pdb.gz	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
10	AFDB:Q9W707	0.162	0.211	4.297E-9	372	0.157	0.207	Q9W707.pdb.gz	FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1
11	PDB:2hdcA	0.137	0.563	2.706E-5	97	0.069	0.351	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:6labV	0.121	0.414	4.309E-2	109	0.043	0.193	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
13	PDB:6qpqD	0.122	0.549	4.893E-2	82	0.018	0.110	6qpqD.pdb.gz
14	PDB:6zmiCE	0.120	0.700	5.921E-2	72	0.020	0.139	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:2nyxB	0.113	0.322	1.191E-1	147	0.016	0.054	2nyxB.pdb.gz
16	PDB:7k5yU	0.115	0.572	1.637E-1	75	0.033	0.213	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
17	PDB:3euhC	0.124	0.264	1.859E-1	206	0.028	0.068	3euhC.pdb.gz
18	PDB:6i6mB	0.119	0.156	1.859E-1	357	0.022	0.031	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
19	PDB:5xohA	0.107	0.142	2.397E-1	348	0.024	0.034	5xohA.pdb.gz	Crystal structure of bergaptol o-methyltransferase complex
20	PDB:2qbyB	0.113	0.144	2.722E-1	368	0.020	0.027	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MYZ6	0.0	957	492	1.000	1.000	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
2	Q70KY4	0.0	580	559	0.646	0.569	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
3	Q9WVH3	1.78e-91	289	505	0.441	0.430	FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus OX=10090 GN=Foxo4 PE=1 SV=1
4	A3RK75	4.52e-85	276	629	0.337	0.264	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
5	O43524	1.12e-84	276	673	0.335	0.245	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
6	Q9W7F8	1.80e-84	275	651	0.350	0.264	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
7	F1NNE8	2.00e-84	275	660	0.305	0.227	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
8	P98177	1.06e-83	269	505	0.301	0.293	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
9	Q5I0F7	1.14e-83	273	643	0.364	0.278	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
10	A3RK74	3.03e-82	269	652	0.289	0.218	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
11	D4A433	1.51e-80	261	505	0.295	0.287	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
12	G3V7R4	8.43e-79	260	649	0.276	0.210	FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus OX=10116 GN=Foxo1 PE=1 SV=1
13	Q9R1E0	8.81e-79	260	652	0.276	0.209	FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus OX=10090 GN=Foxo1 PE=1 SV=2
14	D3ZBQ1	9.69e-79	261	672	0.323	0.237	D3ZBQ1_RAT Forkhead box O3 OS=Rattus norvegicus OX=10116 GN=Foxo3 PE=1 SV=1
15	Q9WVH4	1.71e-78	260	672	0.297	0.217	FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus OX=10090 GN=Foxo3 PE=1 SV=1
16	F1RME6	2.74e-78	259	662	0.283	0.210	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
17	A4L7N3	1.72e-77	257	662	0.280	0.208	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
18	Q12778	4.97e-76	253	655	0.268	0.202	FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2
19	A0A096MJF0	1.78e-65	220	450	0.335	0.367	A0A096MJF0_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=2
20	Q95V55	4.92e-61	212	613	0.238	0.191	FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster OX=7227 GN=foxo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.3e-21	87.8	Forkhead domain
2	PF16676 FOXO-TAD	1.5e-17	75.1	Transactivation domain of FOXO protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016857

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005949	0.825	V-akt murine thymoma viral oncogene homolog 1
2	60711.ENSCSAP00000000122	0.815	V-akt murine thymoma viral oncogene homolog 2
3	60711.ENSCSAP00000005583	0.815	V-akt murine thymoma viral oncogene homolog 3
4	60711.ENSCSAP00000006039	0.716	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
5	60711.ENSCSAP00000007735	0.706	Forkhead box O4
6	60711.ENSCSAP00000010345	0.702	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
7	60711.ENSCSAP00000007481	0.681	NAD-dependent protein deacetylase.
8	60711.ENSCSAP00000011269	0.680	Forkhead box O3
9	60711.ENSCSAP00000014150	0.679	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
10	60711.ENSCSAP00000014681	0.678	Glucose-6-phosphatase, catalytic subunit
11	60711.ENSCSAP00000013863	0.673	Forkhead box O1
12	60711.ENSCSAP00000006746	0.659	F-box protein 32
13	60711.ENSCSAP00000001726	0.636	Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.
14	60711.ENSCSAP00000008198	0.619	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
15	60711.ENSCSAP00000018906	0.617	Forkhead box G1
16	60711.ENSCSAP00000017357	0.581	Stratifin
17	60711.ENSCSAP00000010211	0.571	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
18	60711.ENSCSAP00000000306	0.565	NAD-dependent protein deacetylase.
19	60711.ENSCSAP00000003421	0.564	Uncharacterized protein
20	60711.ENSCSAP00000003766	0.560	Sirtuin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.992	DNA binding
GO:0043565	0.975	sequence-specific DNA binding
GO:0003700	0.970	DNA-binding transcription factor activity
GO:0000981	0.916	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.826	double-stranded DNA binding
GO:1990837	0.747	sequence-specific double-stranded DNA binding
GO:0000976	0.525	transcription cis-regulatory region binding
GO:0001216	0.379	DNA-binding transcription activator activity
GO:0001228	0.364	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.306	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0048518	0.971	positive regulation of biological process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0010468	0.926	regulation of gene expression
GO:0010556	0.916	regulation of macromolecule biosynthetic process
GO:0031326	0.916	regulation of cellular biosynthetic process
GO:0019219	0.908	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.899	regulation of DNA-templated transcription
GO:0006357	0.850	regulation of transcription by RNA polymerase II
GO:0009987	0.827	cellular process
GO:0032501	0.787	multicellular organismal process
GO:0048522	0.775	positive regulation of cellular process
GO:0048519	0.654	negative regulation of biological process
GO:0050896	0.566	response to stimulus
GO:0032502	0.539	developmental process
GO:0048856	0.532	anatomical structure development
GO:0050793	0.489	regulation of developmental process
GO:0051716	0.445	cellular response to stimulus
GO:0065009	0.441	regulation of molecular function
GO:0048523	0.406	negative regulation of cellular process
GO:0009893	0.402	positive regulation of metabolic process
GO:0007275	0.394	multicellular organism development
GO:0031325	0.376	positive regulation of cellular metabolic process
GO:0051173	0.375	positive regulation of nitrogen compound metabolic process
GO:0010605	0.374	negative regulation of macromolecule metabolic process
GO:0009891	0.367	positive regulation of biosynthetic process
GO:0008152	0.365	metabolic process
GO:0051239	0.363	regulation of multicellular organismal process
GO:0010604	0.357	positive regulation of macromolecule metabolic process
GO:0071704	0.341	organic substance metabolic process
GO:0051094	0.332	positive regulation of developmental process
GO:0051172	0.323	negative regulation of nitrogen compound metabolic process
GO:0031328	0.319	positive regulation of cellular biosynthetic process
GO:0031324	0.315	negative regulation of cellular metabolic process
GO:0042127	0.311	regulation of cell population proliferation
GO:0044238	0.310	primary metabolic process
GO:0048731	0.303	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.958	cytosol
GO:0032991	0.920	protein-containing complex
GO:0043232	0.543	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]