StarFunc result for job id A8MZ36

User Input

>input (301 residues)
MQASADQVERDILETQKRLQQDRLNSEQSQALQHQQETGSSLKEAEVLLKDLFLDVDKAR
RLKHPQAEETEKDIEQLHERVTQECAEYCALYEKMVLPPRRGIQGRLGTRAGAETEAGLR
RPVWAGHGGAGGTDRGAQHRAEGDQRPRRAAAEPGGAGCRHHPEPIPRPTEGGVVARAEP
GQPVHALQGCTWQLSALAEQQRRILQQDWSDLMADPAGVRREYEHFKQHELLSQEQSVNQ
LEEDGKRMVELRHPAVGPIQAHQEALKMEWQNFLNLCICQETQLQHVEDYSRILCPSSSP
H

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92817	0.352	0.053	4.983E-19	2033	0.684	0.101	Q92817.pdb.gz	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
2	AFDB:Q9D952	0.358	0.054	7.412E-18	2035	0.628	0.093	Q9D952.pdb.gz	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
3	AFDB:Q9R269	0.350	0.061	7.111E-9	1755	0.259	0.044	Q9R269.pdb.gz	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
4	AFDB:O60437	0.351	0.061	1.614E-8	1756	0.269	0.046	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
5	AFDB:Q503P9	0.354	0.139	1.651E-6	786	0.213	0.081	Q503P9.pdb.gz
6	AFDB:Q2UDB4	0.246	0.279	2.200E-2	263	0.146	0.167	Q2UDB4.pdb.gz	Q2UDB4_ASPOR t-SNARE coiled-coil homology domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090012000240 PE=4 SV=1
7	AFDB:Q03322	0.225	0.291	2.832E-1	224	0.050	0.067	Q03322.pdb.gz	TLG1_YEAST t-SNARE affecting a late Golgi compartment protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TLG1 PE=1 SV=1
8	AFDB:Q8N205	0.201	0.156	3.434E-1	404	0.116	0.087	Q8N205.pdb.gz	SYNE4_HUMAN Nesprin-4 OS=Homo sapiens OX=9606 GN=SYNE4 PE=1 SV=2
9	AFDB:Q80VW7	0.122	0.040	4.586E-1	1404	0.159	0.034	Q80VW7.pdb.gz	AKNA_MOUSE Microtubule organization protein AKNA OS=Mus musculus OX=10090 GN=Akna PE=1 SV=1
10	AFDB:O94988	0.149	0.053	5.050E-1	1023	0.133	0.039	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
11	PDB:6k5lA	0.115	0.075	1.203	565	0.060	0.032	6k5lA.pdb.gz	Characterization of metal binding of bifunctional kinase/phosphatase AceK and implication in activity modulation.
12	PDB:4q66B	0.117	0.076	2.251	507	0.030	0.018	4q66B.pdb.gz	Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
13	PDB:5m6sA	0.263	0.704	2.251	98	0.053	0.163	5m6sA.pdb.gz
14	PDB:7q83D	0.208	0.342	2.730	156	0.056	0.109	7q83D.pdb.gz
15	PDB:3c98B	0.204	0.250	3.007	230	0.040	0.052	3c98B.pdb.gz
16	PDB:3mxzA	0.085	0.205	3.311	107	0.050	0.140	3mxzA.pdb.gz
17	PDB:7nsuD	0.155	0.114	4.869	420	0.050	0.036	7nsuD.pdb.gz
18	PDB:4pw8F	0.145	0.144	5.627	303	0.103	0.102	4pw8F.pdb.gz
19	PDB:6pyzC	0.139	0.126	5.627	333	0.040	0.036	6pyzC.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.
20	PDB:7qenD	0.199	0.070	5.627	1050	0.037	0.010	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKI0	8.81e-121	383	2055	0.718	0.105	K7EKI0_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=1
2	Q92817	1.35e-120	382	2033	0.718	0.106	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
3	Q9D952	2.19e-110	353	2035	0.651	0.096	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
4	Q9R269	4.50e-27	113	1755	0.289	0.050	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
5	O60437	1.72e-25	108	1756	0.279	0.048	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
6	A0A0B4K869	9.96e-08	55.8	5434	0.110	0.006	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A1Z9J2	1.01e-07	55.8	5160	0.110	0.006	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A0A0B4K867	1.02e-07	55.8	5463	0.110	0.006	A0A0B4K867_DROME Short stop, isoform Y OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A0A0B4K788	1.05e-07	55.8	5462	0.110	0.006	A0A0B4K788_DROME Short stop, isoform AC OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	E1JH65	1.05e-07	55.8	5458	0.110	0.006	E1JH65_DROME Short stop, isoform P OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	B7YZG6	1.07e-07	55.8	5479	0.110	0.006	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	A1Z9J3	1.08e-07	55.8	8805	0.110	0.004	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	B7YZG5	1.09e-07	55.8	5486	0.110	0.006	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	E1JH64	1.09e-07	55.8	5155	0.110	0.006	E1JH64_DROME Short stop, isoform Q OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A1Z9J1	1.10e-07	55.5	5501	0.110	0.006	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	E1JH63	1.10e-07	55.5	5499	0.110	0.006	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	P30427	1.10e-07	55.5	4687	0.239	0.015	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
18	Q7KJN8	1.17e-07	55.5	5201	0.110	0.006	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
19	A1Z9J0	1.18e-07	55.5	5201	0.110	0.006	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	A0A0B4K7Y9	1.19e-07	55.5	5408	0.110	0.006	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16884 ADH_N_2	4.8e+02	12.1	N-terminal domain of oxidoreductase
2	PF00435 Spectrin	31	16.5	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331678	0.633	Plakophilin-3
2	9606.ENSP00000257192	0.609	Desmoglein-1
3	9606.ENSP00000257189	0.600	Desmoglein-3
4	9606.ENSP00000263946	0.587	Plakophilin-1
5	9606.ENSP00000070846	0.567	Plakophilin-2
6	9606.ENSP00000257198	0.528	Desmocollin-1
7	9606.ENSP00000353608	0.527	Desmocollin-3
8	9606.ENSP00000352785	0.526	Desmoglein-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0032502	0.958	developmental process
GO:0065007	0.877	biological regulation
GO:0050789	0.736	regulation of biological process
GO:0050794	0.656	regulation of cellular process
GO:0032501	0.539	multicellular organismal process
GO:0048856	0.483	anatomical structure development
GO:0071840	0.417	cellular component organization or biogenesis
GO:0016043	0.403	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0005829	0.992	cytosol
GO:0016020	0.961	membrane
GO:0071944	0.947	cell periphery
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005886	0.913	plasma membrane
GO:0043227	0.639	membrane-bounded organelle
GO:0005856	0.521	cytoskeleton
GO:0045111	0.438	intermediate filament cytoskeleton
GO:0043231	0.406	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]