StarFunc result for job id A8TX70

User Input

>input (2615 residues)
MKILLIIFVLIIWTETLADQSPGPGPVYADVVFLVDSSDHLGPKSFPFVKTFINKMINSL
PIEANKYRVALAQYSDEFHSEFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRT
YFSAPINGRDRKQFPPILVVLASAESEDEVEEASKALQKDGVKIISVGVQKASEENLKAM
ATSHFHFNLRTIRDLSTFSQNMTQIIKDVTKYKEGAVDADMQVHFPISCQKDSLADLVFL
VDESLGTGGNLRHLQTFLENITSSMDVKENCMRLGLMSYSNSAKTISFLKSSTTQSEFQQ
QIKNLSIQVGKSNTGAAIDQMRRDGFSESYGSRRAQGVPQIAVLVTHRPSDDEVHDAALN
LRLEDVNVFALSIQGANNTQLEEIVSYPPEQTISTLKSYADLETYSTKFLKKLQNEIWSQ
ISTYAEQRNLDKTGCVDTKEADIHFLIDGSSSIQEKQFEQIKRFMLEVTEMFSIGPDKVR
VGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRM
SKVPCYLIVLTDGMSTDRVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQ
NFDALKSIKNEVVREICAEKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQI
GADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTH
SKGARLGAKKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSL
VFHVENFDHLKALERKLIFRVCALHDCKRITLLDVVFVLDHSGSIKKQYQDHMINLTIHL
VKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA
NALFTEEHGSRIKQNVKQMLIVITDGESHDHDQLNDTALELRNKGITIFAVGVGKANQKE
LEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTEAPEVCHLQEADVIFLCDGSDRVSNSD
FVTMTTFLSDLIDNFDIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQIQNVSKSGG
FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDPRYDVADAVKTLKDLGICVLVL
GIGDVYKEHLLPITGNSEKIITFQDFDKLKNVDVKKRIIREICQSCGKTNCFMDIVVGFD
ISTHVQGQPLFQGHPQLESYLPGILEDISSIKGVSCGAGTEAQVSLAFKVNSDQGFPAKF
QIYQKAVFDSLLQVNVSGPTHLNAQFLRSLWDTFKDKSASRGQVLLIFSDGLQSESNIML
ENQSDRLREAGLDALLVVSLNTTAHHEFSSFEFGKRFDYRTHLTIGMRELGKKLSQYLGN
IAERTCCCTFCKCPGIPGPHGTRGLQAMKGSQGLKGSRGHRGEDGNPGVRGDTGPQGDKG
IAGCPGAWGQKGLKGFSGPKGGHGDDGIDGLDGEEGCHGFPGIKGEKGDPGSQGSPGSRG
APGQYGEKGFPGDPGNPGQNNNIKGQKGSKGEQGRQGRSGQKGVQGSPSSRGSRGREGQR
GLRGVSGEPGNPGPTGTLGAEGLQGPQGSQGNPGRKGEKGSQGQKGPQGSPGLMGAKGST
GRPGLLGKKGEPGLPGDLGPVGQTGQRGRQGDSGIPGYGQMGRKGVKGPRGFPGDAGQKG
DIGNPGIPGGPGPKGFRGLALTVGLKGEEGSRGLPGPPGQRGIKGMAGQPVYSQCDLIRF
LREHSPCWKEKCPAYPTELVFALDNSYDVTEESFNKTRDIITSIVNDLNIRENNCPVGAR
VAMVSYNSGTSYLIRWSDYNRKKQLLQQLSQIKYQDTTEPRDVGNAMRFVTRNVFKRTYA
GANVRRVAVFFSNGQTASRSSIITATMEFSALDISPTVFAFDERVFLEAFGFDNTGTFQV
IPVPPNGENQTLERLRRCALCYDKCFPNACIREAFLPEDSYMDVVFLIDNSRNIAKDEFK
AVKALVSSVIDNFNIASDPLISDSGDRIALLSYSPWESSRRKMGTVKTEFDFITYDNQLL
MKNHIQTSFQQLNGEATIGRALLWTTENLFPETPYLRKHKVIFVVSAGENYERKEFVKMM
ALRAKCQGYVIFVISLGSTRKDDMEELASYPLDQHLIQLGRIHKPDLNYIAKFLKPFLYS
VRRGFNQYPPPMLEDACRLINLGGENIQNDGFQFVTELQEDFLGGNGFIGQELNSGRESP
FVKTEDNGSDYLVYLPSQMFEPQKLMINYEKDQKSAEIASLTSGHENYGRKEEPDHTYEP
GDVSLQEYYMDVAFLIDASQRVGSDEFKEVKAFITSVLDYFHIAPTPLTSTLGDRVAVLS
YSPPGYMPNTEECPVYLEFDLVTYNSIHQMKHHLQDSQQLNGDVFIGHALQWTIDNVFVG
TPNLRKNKVIFVISAGETNSLDKDVLRNVSLRAKCQGYSIFVFSFGPKHNDKELEELASH
PLDHHLVQLGRTHKPDWNYIIKFVKPFVHLIRRAINKYPTEDMKATCVNMTSPNPENGGT
ENTVLLLPGIYEIKTENGDLFDEFDSQAQHLLVLGNNHSSGSETATDLMQKLYLLFSTEK
LAMKDKEKAHLEEISALVVDKQQEKEDKEMEATDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6H584	0.455	0.451	0.000	2640	0.732	0.725	A6H584.pdb.gz	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
2	AFDB:A6NMZ7	0.475	0.543	0.000	2263	0.458	0.529	A6NMZ7.pdb.gz	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
3	AFDB:A8TX70	1.000	1.000	0.000	2615	1.000	1.000	A8TX70.pdb.gz	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
4	AFDB:Q8C6K9	0.462	0.526	0.000	2265	0.454	0.524	Q8C6K9.pdb.gz	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
5	PDB:4nehA	0.061	0.143	2.811E-9	1084	0.022	0.053	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
6	PDB:4nenA	0.059	0.142	7.357E-9	1063	0.021	0.053	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
7	PDB:2xwbF	0.066	0.225	1.288E-6	714	0.016	0.060	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
8	PDB:6orbA	0.065	0.051	1.577E-6	3352	0.014	0.011	6orbA.pdb.gz
9	PDB:6gym6	0.062	0.448	3.547E-6	335	0.011	0.087	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
10	PDB:6jp8F	0.065	0.169	4.129E-6	973	0.010	0.028	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
11	PDB:7ad8D	0.059	0.480	2.196E-5	280	0.010	0.093	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:7zs96	0.061	0.383	2.975E-5	383	0.010	0.065	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
13	PDB:7ena2	0.061	0.377	3.833E-5	385	0.009	0.060	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:6qfbB	0.045	0.098	1.504E-4	1035	0.024	0.062	6qfbB.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
15	AFDB:O95487	0.066	0.118	6.969E-4	1268	0.045	0.093	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
16	AFDB:Q3U2P1	0.060	0.128	9.443E-4	1090	0.041	0.099	Q3U2P1.pdb.gz	SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus OX=10090 GN=Sec24a PE=1 SV=1
17	AFDB:Q9M291	0.075	0.148	1.490E-3	1096	0.048	0.114	Q9M291.pdb.gz	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
18	AFDB:E9PYK3	0.063	0.082	2.600E-3	1969	0.042	0.056	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
19	AFDB:Q8I398	0.032	0.038	8.138E-2	2112	0.062	0.077	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
20	AFDB:Q586D8	0.042	0.062	8.560E-2	1522	0.076	0.130	Q586D8.pdb.gz	Q586D8_TRYB2 Present in the outer mitochondrial membrane proteome 22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.135 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WS16	0.0	912	2677	0.267	0.261	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
2	A0A287BK35	0.0	1429	2337	0.274	0.306	A0A287BK35_PIG Collagen type VI alpha 5 chain OS=Sus scrofa OX=9823 GN=COL6A5 PE=1 SV=2
3	A0A8I5ZTR6	0.0	941	3109	0.273	0.230	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
4	A0A8I6ADR1	0.0	908	2708	0.268	0.259	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
5	A0A8I6AHL9	0.0	942	3316	0.274	0.216	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
6	A2AX52	0.0	1094	2309	0.289	0.328	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
7	A6H584	0.0	3872	2640	0.733	0.726	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
8	A6NMZ7	0.0	2214	2263	0.454	0.525	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
9	A8TX70	0.0	5421	2615	1.000	1.000	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
10	E9PWQ3	0.0	950	3284	0.273	0.218	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
11	J3QQ16	0.0	912	2677	0.267	0.261	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
12	O88493	0.0	918	2657	0.262	0.258	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
13	P12111	0.0	927	3177	0.265	0.218	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
14	Q8C6K9	0.0	2231	2265	0.452	0.522	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
15	Q05504	1.38e-143	477	959	0.129	0.352	Q05504_MOUSE Collagen alpha 3 chain type VI (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
16	Q9Z0I9	6.89e-116	411	1703	0.129	0.198	Q9Z0I9_MOUSE Collagen alpha3(VI) (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
17	D3YWD1	1.18e-115	410	1703	0.129	0.198	D3YWD1_MOUSE Collagen, type VI, alpha 3 (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
18	F5GZK2	1.82e-54	211	956	0.091	0.250	F5GZK2_HUMAN Collagen type XXI alpha 1 chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=1 SV=2
19	A0A158RFW1	2.31e-54	210	957	0.091	0.250	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
20	Q96P44	2.31e-54	210	957	0.091	0.250	COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13911 AhpC-TSA_2	2.3e+02	13.3	AhpC/TSA antioxidant enzyme
2	PF01391 Collagen	4.1e-41	149.9	Collagen triple helix repeat (20 copies)
3	PF07002 Copine	0.0011	30.0	Copine
4	PF01965 DJ-1_PfpI	3.2e+02	12.5	DJ-1/PfpI family
5	PF10740 DUF2529	3.5e+02	12.2	Domain of unknown function (DUF2529)
6	PF17930 LpxI_N	3.5	19.0	LpxI N-terminal domain
7	PF04055 Radical_SAM	0.0027	29.6	Radical SAM superfamily
8	PF00092 VWA	2.5e-277	921.9	von Willebrand factor type A domain
9	PF10138 vWA-TerF-like	4.3	18.9	vWA found in TerF C terminus
10	PF13519 VWA_2	1.5e-94	323.2	von Willebrand factor type A domain
11	PF13768 VWA_3	3.1e-20	84.2	von Willebrand factor type A domain
12	PF05762 VWA_CoxE	4.3e-08	44.4	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295550	0.920	Collagen alpha-3(VI) chain
2	9606.ENSP00000300527	0.919	Collagen alpha-2(VI) chain
3	9606.ENSP00000355180	0.919	Collagen alpha-1(VI) chain
4	9606.ENSP00000452786	0.912	Integrin beta-3
5	9606.ENSP00000351310	0.908	Collagen alpha-6(VI) chain
6	9606.ENSP00000264474	0.905	Cystatin-A
7	9606.ENSP00000282588	0.905	Integrin alpha-1
8	9606.ENSP00000379350	0.905	Integrin beta-1
9	9606.ENSP00000296585	0.904	Integrin alpha-2
10	9606.ENSP00000370542	0.904	Syndecan-1
11	9606.ENSP00000401749	0.904	Prolyl 4-hydroxylase subunit alpha-3
12	9606.ENSP00000261023	0.902	Integrin alpha-V
13	9606.ENSP00000263556	0.902	Prolyl 4-hydroxylase subunit alpha-1
14	9606.ENSP00000384999	0.902	Prolyl 4-hydroxylase subunit alpha-2
15	9606.ENSP00000351273	0.900	Caspase-8
16	9606.ENSP00000278888	0.739	High affinity immunoglobulin epsilon receptor subunit beta
17	9606.ENSP00000367316	0.682	Integrin alpha-8
18	9606.ENSP00000264741	0.672	Integrin alpha-9
19	9606.ENSP00000293379	0.647	Integrin alpha-5
20	9606.ENSP00000452120	0.647	Integrin alpha-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:0044877	0.509	protein-containing complex binding
GO:0005518	0.314	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.999	anatomical structure development
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.992	cellular process
GO:0007275	0.979	multicellular organism development
GO:0048513	0.923	animal organ development
GO:0048731	0.867	system development
GO:0048869	0.804	cellular developmental process
GO:0030154	0.763	cell differentiation
GO:0007399	0.733	nervous system development
GO:0016043	0.726	cellular component organization
GO:0061061	0.591	muscle structure development
GO:0009653	0.543	anatomical structure morphogenesis
GO:0065007	0.458	biological regulation
GO:0050789	0.399	regulation of biological process
GO:0050896	0.381	response to stimulus
GO:0120036	0.336	plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005576	0.986	extracellular region
GO:0070013	0.363	intracellular organelle lumen
GO:0005737	0.362	cytoplasm
GO:0032991	0.345	protein-containing complex
GO:0012505	0.345	endomembrane system
GO:0016020	0.329	membrane
GO:0043231	0.313	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]