StarFunc result for job id A9YTQ3

User Input

>input (701 residues)
MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPD
IISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLL
ESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMD
PPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFL
TMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADT
AATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCL
RGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRL
QPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQV
HPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKME
KDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQP
HGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVK
REPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A9YTQ3	0.999	0.999	0.000	701	1.000	1.000	A9YTQ3.pdb.gz	AHRR_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3
2	AFDB:Q3U1U7	0.464	0.464	5.972E-66	701	0.612	0.612	Q3U1U7.pdb.gz	AHRR_MOUSE Aryl hydrocarbon receptor repressor OS=Mus musculus OX=10090 GN=Ahrr PE=1 SV=1
3	AFDB:E5L8C8	0.414	0.386	3.030E-55	756	0.486	0.451	E5L8C8.pdb.gz	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
4	PDB:2wkpA	0.100	0.195	1.157E-3	320	0.023	0.050	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
5	AFDB:P07663	0.109	0.067	2.691E-3	1224	0.151	0.087	P07663.pdb.gz	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
6	PDB:6umzA	0.098	0.433	3.240E-3	127	0.033	0.181	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
7	PDB:7rzwB	0.101	0.083	2.391E-2	864	0.029	0.023	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
8	AFDB:Q86XJ1	0.076	0.077	2.530E-2	694	0.146	0.147	Q86XJ1.pdb.gz	GA2L3_HUMAN GAS2-like protein 3 OS=Homo sapiens OX=9606 GN=GAS2L3 PE=1 SV=1
9	PDB:3t1rC	0.066	0.255	5.581E-2	136	0.027	0.140	3t1rC.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
10	AFDB:Q8R361	0.055	0.059	7.526E-2	645	0.136	0.147	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
11	AFDB:Q9BXF6	0.058	0.053	1.654E-1	653	0.108	0.116	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
12	AFDB:F5H7T0	0.057	0.049	1.983E-1	854	0.134	0.110	F5H7T0.pdb.gz	F5H7T0_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=1
13	AFDB:Q08D68	0.056	0.047	2.853E-1	853	0.148	0.122	Q08D68.pdb.gz	ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis OX=8364 GN=znrf3 PE=1 SV=1
14	PDB:3ugtC	0.062	0.090	2.864E-1	427	0.039	0.063	3ugtC.pdb.gz	Yeast mitochondrial threonyl-tRNA synthetase recognizes tRNA isoacceptors by distinct mechanisms and promotes CUN codon reassignment.
15	PDB:5loeA	0.071	0.156	2.864E-1	258	0.034	0.093	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
16	AFDB:F1QPU2	0.073	0.038	3.220E-1	1719	0.153	0.062	F1QPU2.pdb.gz	F1QPU2_DANRE Structure-specific endonuclease subunit SLX4 OS=Danio rerio OX=7955 GN=slx4 PE=3 SV=1
17	PDB:7kzmI	0.080	0.315	3.649E-1	103	0.020	0.136	7kzmI.pdb.gz	Structure of a microtubule-bound axonemal dynein.
18	PDB:3bhdA	0.047	0.097	3.876E-1	211	0.031	0.104	3bhdA.pdb.gz
19	PDB:7vbaN	0.075	0.254	3.876E-1	151	0.027	0.126	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
20	PDB:6kg7A	0.064	0.032	9.051E-1	1817	0.056	0.021	6kg7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9YTQ3	0.0	1425	701	1.000	1.000	AHRR_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3
2	D6RE68	0.0	1124	557	0.785	0.987	D6RE68_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1
3	E5L8C8	0.0	571	756	0.505	0.468	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
4	Q3U1U7	0.0	797	701	0.621	0.621	AHRR_MOUSE Aryl hydrocarbon receptor repressor OS=Mus musculus OX=10090 GN=Ahrr PE=1 SV=1
5	Q3T2L2	5.71e-117	364	573	0.250	0.305	Q3T2L2_DANRE Aryl hydrocarbon receptor repressor 2 OS=Danio rerio OX=7955 GN=ahrr2 PE=2 SV=1
6	Q3T2L3	6.81e-109	343	550	0.254	0.324	Q3T2L3_DANRE Aryl hydrocarbon receptor repressor 1 OS=Danio rerio OX=7955 GN=ahrr1 PE=2 SV=1
7	P35869	1.41e-96	318	848	0.280	0.231	AHR_HUMAN Aryl hydrocarbon receptor OS=Homo sapiens OX=9606 GN=AHR PE=1 SV=2
8	Q9PTI7	1.72e-96	318	858	0.261	0.213	Q9PTI7_CHICK Aryl hydrocarbon receptor OS=Gallus gallus OX=9031 GN=AHR PE=2 SV=2
9	Q9I9E2	2.12e-96	318	858	0.261	0.213	Q9I9E2_CHICK Aryl hydrocarbon receptor OS=Gallus gallus OX=9031 GN=AHR1A PE=2 SV=1
10	Q4U3K9	4.70e-94	314	940	0.260	0.194	Q4U3K9_DANRE Aryl hydrocarbon receptor OS=Danio rerio OX=7955 GN=si:dkey-159d6.1 PE=2 SV=1
11	P41738	8.33e-92	306	853	0.254	0.209	AHR_RAT Aryl hydrocarbon receptor OS=Rattus norvegicus OX=10116 GN=Ahr PE=1 SV=2
12	P30561	2.96e-90	301	848	0.250	0.206	AHR_MOUSE Aryl hydrocarbon receptor OS=Mus musculus OX=10090 GN=Ahr PE=1 SV=3
13	Q9YGV3	1.58e-80	278	1027	0.233	0.159	Q9YGV3_DANRE Aryl hydrocarbon receptor OS=Danio rerio OX=7955 GN=AHR2 PE=2 SV=1
14	Q8QGQ3	4.71e-78	268	805	0.231	0.201	Q8QGQ3_DANRE Aryl hydrocarbon receptor type 1 OS=Danio rerio OX=7955 GN=ahr1 PE=2 SV=1
15	O61543	3.41e-61	222	884	0.188	0.149	O61543_DROME Ahr homolog spineless OS=Drosophila melanogaster OX=7227 GN=ss PE=2 SV=1
16	Q9VEV9	1.21e-60	221	884	0.187	0.148	Q9VEV9_DROME Spineless, isoform A OS=Drosophila melanogaster OX=7227 GN=ss PE=4 SV=1
17	E1JIM6	5.65e-60	220	1015	0.187	0.129	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
18	E1C4K6	7.53e-57	210	882	0.198	0.158	E1C4K6_CHICK Aryl hydrocarbon receptor 2 OS=Gallus gallus OX=9031 PE=2 SV=3
19	O44712	2.55e-43	167	602	0.163	0.189	AHR_CAEEL Aryl hydrocarbon receptor protein 1 OS=Caenorhabditis elegans OX=6239 GN=ahr-1 PE=1 SV=1
20	P97459	2.60e-20	97.8	594	0.124	0.146	NPAS1_MOUSE Neuronal PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Npas1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	0.075	24.3	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	1.5e-06	39.5	PAS fold
3	PF08447 PAS_3	45	15.7	PAS fold
4	PF08448 PAS_4	18	17.0	PAS fold
5	PF13426 PAS_9	5.7e+02	12.2	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369050	0.982	Cytochrome P450 1A1
2	9606.ENSP00000351407	0.825	Aryl hydrocarbon receptor nuclear translocator
3	9606.ENSP00000258787	0.794	Unconventional myosin-Ig
4	9606.ENSP00000248076	0.753	Proteinase-activated receptor 4
5	9606.ENSP00000307479	0.737	Aryl hydrocarbon receptor nuclear translocator 2
6	9606.ENSP00000286918	0.732	Ankyrin repeat domain-containing protein 9
7	9606.ENSP00000405330	0.730	Estrogen receptor
8	9606.ENSP00000399938	0.724	FLYWCH-type zinc finger 1
9	9606.ENSP00000296785	0.717	Ankyrin repeat family A protein 2
10	9606.ENSP00000304429	0.681	Sorting nexin-7
11	9606.ENSP00000309141	0.680	E3 ubiquitin-protein ligase MARCH3
12	9606.ENSP00000478561	0.658	Cytochrome P450 1B1
13	9606.ENSP00000289416	0.654	Acyl-coenzyme A synthetase ACSM3, mitochondrial
14	9606.ENSP00000261435	0.609	NEDD4-binding protein 2
15	9606.ENSP00000282369	0.599	E3 ubiquitin-protein ligase TRIM36
16	9606.ENSP00000419851	0.578	GMP synthase [glutamine-hydrolyzing]
17	9606.ENSP00000359357	0.571	Zinc finger protein Gfi-1
18	9606.ENSP00000284311	0.556	G-protein coupled receptor 15
19	9606.ENSP00000420612	0.547	TCDD-inducible poly [ADP-ribose] polymerase
20	9606.ENSP00000354778	0.541	Contactin-associated protein-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.987	nucleic acid binding
GO:0003677	0.980	DNA binding
GO:0043565	0.810	sequence-specific DNA binding
GO:1990837	0.699	sequence-specific double-stranded DNA binding
GO:0140110	0.573	transcription regulator activity
GO:0000976	0.504	transcription cis-regulatory region binding
GO:0003700	0.358	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050896	0.987	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0009987	0.961	cellular process
GO:0042221	0.958	response to chemical
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0080090	0.937	regulation of primary metabolic process
GO:0031323	0.933	regulation of cellular metabolic process
GO:0010556	0.928	regulation of macromolecule biosynthetic process
GO:0006357	0.922	regulation of transcription by RNA polymerase II
GO:0048519	0.674	negative regulation of biological process
GO:0045892	0.648	negative regulation of DNA-templated transcription
GO:0051716	0.615	cellular response to stimulus
GO:0070887	0.508	cellular response to chemical stimulus
GO:0048518	0.506	positive regulation of biological process
GO:0008152	0.462	metabolic process
GO:0009893	0.366	positive regulation of metabolic process
GO:0009410	0.336	response to xenobiotic stimulus
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.991	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]