StarFunc result for job id A9Z1Z3

User Input

>input (1794 residues)
MFSPLKSRARALAHGDPFQVSRAQDFQVGVTVLEAQKLVGVNINPYVAVQVGGQRRVTAT
QRGTSCPFYNEYFLFEFHDTRLRLQDLLLEITAFHSQTLPFMATRIGTFRMDLGIILDQP
DGQFYQRWVPLHDPRDTRAGTKGFIKVTLSVRARGDLPPPMLPPAPGHCSDIEKNLLLPR
GVPAERPWARLRVRLYRAEGLPALRLGLLGSLVRALHDQRVLVEPYVRVSFLGQEGETSV
SAEAAAPEWNEQLSFVELFPPLTRSLRLQLRDDAPLVDAALATHVPDLRRISHPGRAAGF
NPTFGPAWVPLYGSPPGAGLRDSLQGLNEGVGQGIWFRGRLLLAVSMQVLEGRAEPEPPQ
AQQGSTLSRLTRKKKKKARRDQTPKAVPQHLDASPGAEGPEIPRAMEVEVEELLPLPENV
LAPCEDFLLFGVLFEATMIDPTVASQPISFEISIGRAGRLEEQLGRGSRAGEGTEGAAVE
AQPLLGARPEEEKEEEELGTHAQRPEPMDGSGPYFCLPLCHCKPCMHVWSCWEDHTWRLQ
SSNCVRKVAERLDQGLQEVERLQRKPGPGACAQLKQALEVLVAGSRQFCHGAERRTMTRP
NALDRCRGKLLVHSLNLLAKQGLRLLRGLRRRNVQKKVALAKKLLAKLRFLAEEPQPPLP
DVLVWMLSGQRRVAWARIPAQDVLFSVVEEERGRDCGKIQSLMLTAPGAAPGEVCAKLEL
FLRLGLGKQAKACTSELPPDLLPEPSAGLPSSLHRDDFSYFQLRAHLYQARGVLAADDSG
LSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFEQLIVDGRREHLQEEPPLVIINVFDH
NKFGPPVFLGRALAAPRVKLMEDPYQRPELQFFPLRKGPWAAGELIAAFQLIELDYSGRL
EPSVPSEVEPQDLAPLVEPHSGRLSLPPNVCPVLREFRVEVLFWGLRGLGRVHLLEVEQP
QVVLEVAGQGVESEVLASYRESPNFTELVRHLTVDLPEQPYLQPPLSILVIERRAFGHTV
LVGSHIVPHMLRFTFRGHEDPPEEEGEMEETGDMMPKGPQGQKSLDPFLAEAGISRQLLK
PPLKKLPLGGLLNQGPGLEEDIPDPEELDWGSKYYASLQELQGQHNFDEDEMDDPGDSDG
VNLISMVGEIQDQGEAEVKGTVSPKKAVATLKIYNRSLKEEFNHFEDWLNVFPLYRGQGG
QDGGGEEEGSGHLVGKFKGSFLIYPESEAVLFSEPQISRGIPQNRPIKLLVRVYVVKATN
LAPADPNGKADPYVVVSAGRERQDTKERYIPKQLNPIFGEILELSISLPAETELTVAVFD
HDLVGSDDLIGETHIDLENRFYSHHRANCGLASQYEVDGYNAWRDAFWPSQILAGLCQRC
GLPAPEYRAGAVKVGSKVFLTPPETLPPGSSSPTVASGDPEEAQALLVLRRWQEMPGFGI
QLVPEHVETRPLYHPHSPGLLQGSLHMWIDIFPQDVPAPPPVDIKPRQPISYELRVVIWN
TEDVVLDDENPLTGEMSSDIYVKSWVKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYL
PTEREVSVWRRSGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARG
PELCSVQLARNGAGPRCNLFRCRRLRGWWPVVKLKEAEDVEREAQEAQAGKKKRKQRRRK
GRPEDLEFTDMGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKQPEPLEKPSRPKTSFN
WFVNPLKTFVFFIWRRYWRTLVLLLLVLLTVFLLLVFYTIPGQISQVIFRPLHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7Z0E5	0.674	0.729	0.000	1647	0.213	0.233	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
2	AFDB:E0CZ42	0.778	0.751	0.000	1862	0.416	0.401	E0CZ42.pdb.gz	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	AFDB:E7F4H1	0.575	0.499	0.000	2097	0.318	0.272	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
4	AFDB:E7FGH7	0.771	0.773	0.000	1790	0.393	0.394	E7FGH7.pdb.gz
5	AFDB:F8W4A8	0.809	0.819	0.000	1773	0.390	0.395	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
6	AFDB:Q17388	0.539	0.483	0.000	2034	0.235	0.207	Q17388.pdb.gz	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
7	AFDB:Q5SPC5	0.772	0.701	0.000	1992	0.406	0.365	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
8	AFDB:Q9ERC5	0.811	0.733	0.000	1993	0.402	0.362	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
9	AFDB:Q9ESD7	0.550	0.481	0.000	2090	0.325	0.279	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
10	AFDB:Q9ESF1	0.800	0.722	0.000	1997	0.407	0.366	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
11	PDB:5iz5B	0.072	0.151	6.899E-10	746	0.031	0.074	5iz5B.pdb.gz
12	PDB:6kxkD	0.063	0.182	5.529E-9	553	0.025	0.080	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5ixcA	0.062	0.158	7.821E-9	684	0.026	0.067	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5iz5A	0.065	0.147	5.402E-8	757	0.025	0.059	5iz5A.pdb.gz
15	PDB:5izrC	0.061	0.161	7.641E-8	659	0.025	0.068	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:1cjyA	0.062	0.169	3.060E-7	633	0.015	0.043	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:5a50A	0.054	0.527	1.822E-6	165	0.019	0.206	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a52A	0.047	0.523	1.139E-5	154	0.016	0.182	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:3nsjA	0.055	0.173	1.258E-5	530	0.012	0.042	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:4rj9A	0.060	0.562	1.460E-5	161	0.015	0.168	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E0CZ42	0.0	627	1862	0.182	0.175	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
2	F8W4A8	0.0	1295	1773	0.391	0.395	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
3	Q5SPC5	0.0	1311	1992	0.405	0.365	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
4	Q9ERC5	0.0	1296	1993	0.406	0.365	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
5	Q9ESF1	0.0	1291	1997	0.411	0.370	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
6	Q9HC10	0.0	736	1997	0.223	0.200	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
7	Q69ZN7	8.09e-173	578	2048	0.203	0.178	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
8	Q9ESD7	3.14e-172	577	2090	0.205	0.176	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
9	D4A6X1	7.19e-172	575	2029	0.205	0.181	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
10	O75923	5.58e-171	573	2080	0.206	0.177	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
11	Q9NZM1	1.58e-170	572	2061	0.201	0.175	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
12	F1QIS3	9.64e-168	564	2088	0.203	0.174	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
13	E7F4H1	1.08e-167	564	2097	0.203	0.174	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
14	F6IA09	8.73e-167	561	2088	0.202	0.173	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
15	B7Z0E7	1.96e-98	351	1351	0.160	0.212	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
16	B7Z0E6	5.21e-98	350	1439	0.160	0.199	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
17	B7Z0E8	6.52e-95	324	648	0.103	0.284	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E5	2.64e-89	325	1647	0.103	0.112	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0F0	5.55e-85	305	1045	0.096	0.166	B7Z0F0_DROME Misfire, isoform B OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E9	1.51e-83	305	1398	0.096	0.124	B7Z0E9_DROME Misfire, isoform C OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.8e-56	200.1	C2 domain
2	PF10947 DUF2628	21	16.9	Protein of unknown function (DUF2628)
3	PF08150 FerB	2.5e-19	81.0	FerB (NUC096) domain
4	PF08151 FerI	6.7e-11	53.4	FerI (NUC094) domain
5	PF16165 Ferlin_C	8.7e-62	219.1	Ferlin C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008955630.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008969884.1	0.621	PRKR interacting protein 1 (IL11 inducible)
2	9597.XP_003805108.1	0.593	P53-induced death domain-containing protein 1 isoform X1
3	9597.XP_008955484.1	0.588	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 228 ESTs, 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns
4	9597.XP_003823181.1	0.571	C1GALT1-specific chaperone 1
5	9597.XP_008964990.1	0.568	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.891	protein-containing complex binding
GO:0043167	0.734	ion binding
GO:0046872	0.595	metal ion binding
GO:0005509	0.577	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.901	cellular process
GO:0065007	0.675	biological regulation
GO:0050896	0.659	response to stimulus
GO:0050789	0.541	regulation of biological process
GO:0032501	0.414	multicellular organismal process
GO:0050794	0.337	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.998	membrane-bounded organelle
GO:0016020	0.993	membrane
GO:0012505	0.992	endomembrane system
GO:0005829	0.991	cytosol
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0005886	0.797	plasma membrane
GO:0005634	0.739	nucleus
GO:0031982	0.530	vesicle
GO:0097708	0.413	intracellular vesicle
GO:0031090	0.390	organelle membrane
GO:0031410	0.375	cytoplasmic vesicle
GO:0005576	0.353	extracellular region
GO:0005783	0.324	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]