StarFunc result for job id B0I1T2

User Input

>input (1018 residues)
MEDEEGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGP
EAIARYQGRELYERPPHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIA
AVTNPSQRAEVERVKDVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPIGGH
IHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMT
VHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGL
AVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVY
QRLFEWVVNRINSVMEPRGRDPRRDGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQ
QLFIQLILKQEQEEYEREGITWQSVEYFNNATIVDLVERPHRGILAVLDEACSSAGTITD
RIFLQTLDMHHRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVTYSVEGFIDKNRDFLF
QDFKRLLYNSTDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVR
CIKPNEDKVAGKLDENHCRHQVAYLGLLENVRVRRAGFASRQPYSRFLLRYKMTCEYTWP
NHLLGSDKAAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKA
WRGTLARWRCRRLRAIYTIMRWFRRHKVRAHLAELQRRFQAARQPPLYGRDLVWPLPPAV
LQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGALQGLRQDWGCRRAWARDYL
SSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLD
PDRQYRVMRAVPLEAVTGLSVTSGGDQLVVLHARGQDDLVVCLHRSRPPLDNRVGELVGV
LAAHCQGEGRTLEVRVSDCIPLSHRGVRRLISVEPRPEQPEPDFRCARGSFTLLWPSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F9L8	0.922	0.934	0.000	1004	0.588	0.597	E7F9L8.pdb.gz	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
2	AFDB:F1PRN2	0.890	0.900	0.000	1006	0.597	0.604	F1PRN2.pdb.gz	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
3	AFDB:Q23978	0.852	0.857	0.000	1011	0.491	0.495	Q23978.pdb.gz	MY31D_DROME Unconventional myosin ID OS=Drosophila melanogaster OX=7227 GN=Myo31DF PE=1 SV=1
4	AFDB:Q5SUA5	0.981	0.975	0.000	1024	0.908	0.902	Q5SUA5.pdb.gz	MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus OX=10090 GN=Myo1g PE=1 SV=1
5	AFDB:Q03479	0.738	0.748	5.827E-94	1005	0.394	0.399	Q03479.pdb.gz	MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoE PE=1 SV=2
6	AFDB:P47807	0.675	0.658	1.427E-90	1045	0.389	0.379	P47807.pdb.gz	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
7	AFDB:Q9UBC5	0.665	0.649	5.319E-90	1043	0.404	0.394	Q9UBC5.pdb.gz	MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens OX=9606 GN=MYO1A PE=1 SV=1
8	AFDB:O88329	0.667	0.651	6.378E-90	1043	0.405	0.395	O88329.pdb.gz	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
9	AFDB:Q23979	0.697	0.685	9.272E-89	1035	0.390	0.384	Q23979.pdb.gz	MY61F_DROME Unconventional myosin IC OS=Drosophila melanogaster OX=7227 GN=Myo61F PE=1 SV=3
10	AFDB:A0A286Y9H2	0.697	0.665	1.598E-88	1069	0.397	0.378	A0A286Y9H2.pdb.gz	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
11	PDB:4pa0A	0.573	0.598	3.297E-52	974	0.237	0.247	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.573	0.630	5.016E-51	920	0.233	0.258	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4anjA	0.557	0.570	7.211E-51	995	0.235	0.240	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
14	PDB:4p7hB	0.566	0.603	1.392E-48	952	0.237	0.253	4p7hB.pdb.gz
15	PDB:6ycxB	0.569	0.702	1.934E-47	817	0.203	0.253	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.571	0.641	1.147E-41	896	0.276	0.314	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.523	0.555	5.608E-37	954	0.267	0.285	5tbyA.pdb.gz
18	PDB:4mk0A	0.083	0.126	2.012E-3	631	0.016	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3uzsA	0.084	0.134	2.524E-3	609	0.023	0.038	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:3pvuA	0.081	0.128	3.314E-3	609	0.018	0.030	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	663	1069	0.394	0.375	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	662	1068	0.394	0.375	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A0A3B3IU30	2010	967	0.950	1.000	A0A3B3IU30_HUMAN Myosin IG OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=1
4	A5PF48	632	1026	0.393	0.390	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
5	B0I1S9	669	1136	0.353	0.316	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
6	B0I1T2	2116	1018	1.000	1.000	MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=2
7	E7F5R7	662	1043	0.394	0.384	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
8	E7F9L8	1235	1004	0.588	0.597	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
9	E9PDF6	670	1107	0.353	0.324	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
10	F1PRN2	1294	1006	0.600	0.607	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
11	F5H6E2	672	1039	0.403	0.395	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
12	O00159	671	1063	0.403	0.386	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
13	O43795	669	1136	0.353	0.316	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
14	O88329	699	1043	0.403	0.393	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
15	O94832	1295	1006	0.600	0.607	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
16	P22467	608	994	0.368	0.377	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
17	P46735	666	1107	0.353	0.324	MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus OX=10090 GN=Myo1b PE=1 SV=3
18	P47807	654	1045	0.386	0.376	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
19	P54695	593	1071	0.332	0.316	MYOF_DICDI Myosin IF heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoF PE=3 SV=2
20	Q03479	719	1005	0.387	0.392	MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	31	16.4	AAA ATPase domain
2	PF13238 AAA_18	1.2e+02	14.7	AAA domain
3	PF13401 AAA_22	1.8e+02	13.8	AAA domain
4	PF13934 ELYS	2.3e+02	13.1	Nuclear pore complex assembly
5	PF00063 Myosin_head	5.4e-226	763.6	Myosin head (motor domain)
6	PF06017 Myosin_TH1	1.7e-35	133.9	Unconventional myosin tail, actin- and lipid-binding
7	PF05729 NACHT	1.5e+02	13.7	NACHT domain
8	PF14593 PH_3	5.4e+02	12.0	PH domain
9	PF00158 Sigma54_activat	3.4e+02	12.3	Sigma-54 interaction domain
10	PF02367 TsaE	2.9e+02	12.8	Threonylcarbamoyl adenosine biosynthesis protein TsaE
11	PF03665 UPF0172	4e+02	12.4	Uncharacterised protein family (UPF0172)
12	PF06414 Zeta_toxin	2.3e+02	12.5	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323816	0.794	Aryl hydrocarbon receptor repressor
2	9606.ENSP00000349960	0.789	Actin, cytoplasmic 1
3	9606.ENSP00000458162	0.755	Actin, cytoplasmic 2
4	9606.ENSP00000372023	0.747	Serine/threonine-protein kinase Chk2
5	9606.ENSP00000286918	0.741	Ankyrin repeat domain-containing protein 9
6	9606.ENSP00000399938	0.725	FLYWCH-type zinc finger 1
7	9606.ENSP00000215980	0.720	Centromere protein M
8	9606.ENSP00000309141	0.720	E3 ubiquitin-protein ligase MARCH3
9	9606.ENSP00000369099	0.718	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
10	9606.ENSP00000359357	0.713	Zinc finger protein Gfi-1
11	9606.ENSP00000348128	0.684	Supervillin
12	9606.ENSP00000289416	0.681	Acyl-coenzyme A synthetase ACSM3, mitochondrial
13	9606.ENSP00000354778	0.675	Contactin-associated protein-like 2
14	9606.ENSP00000411355	0.673	Receptor-type tyrosine-protein phosphatase C
15	9606.ENSP00000234313	0.665	Pleckstrin
16	9606.ENSP00000378152	0.652	AKT-interacting protein
17	9606.ENSP00000308405	0.645	Histone H2A.V
18	9606.ENSP00000371194	0.644	Lymphocyte-specific protein 1
19	9606.ENSP00000248076	0.643	Proteinase-activated receptor 4
20	9606.ENSP00000377558	0.641	Keratin, type I cuticular Ha5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	1.000	cytoskeletal motor activity
GO:0005515	1.000	protein binding
GO:0043168	0.999	anion binding
GO:0043325	0.992	phosphatidylinositol-3,4-bisphosphate binding
GO:0005547	0.992	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005546	0.992	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	0.976	cytoskeletal protein binding
GO:0140657	0.963	ATP-dependent activity
GO:0000146	0.924	microfilament motor activity
GO:0044877	0.545	protein-containing complex binding
GO:0003779	0.429	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.990	biological regulation
GO:0050789	0.981	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0051179	0.860	localization
GO:0048518	0.831	positive regulation of biological process
GO:0051234	0.773	establishment of localization
GO:0050896	0.749	response to stimulus
GO:0006810	0.749	transport
GO:0051641	0.598	cellular localization
GO:0002376	0.581	immune system process
GO:0051716	0.558	cellular response to stimulus
GO:0032501	0.498	multicellular organismal process
GO:0016192	0.494	vesicle-mediated transport
GO:0048583	0.465	regulation of response to stimulus
GO:0051649	0.464	establishment of localization in cell
GO:0071840	0.446	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization
GO:0007154	0.345	cell communication
GO:0048856	0.340	anatomical structure development
GO:0023052	0.323	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.998	cell periphery
GO:0043227	0.998	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0005886	0.988	plasma membrane
GO:0070013	0.988	intracellular organelle lumen
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005634	0.983	nucleus
GO:0005737	0.972	cytoplasm
GO:0031981	0.967	nuclear lumen
GO:0005576	0.964	extracellular region
GO:0005654	0.964	nucleoplasm
GO:0031982	0.910	vesicle
GO:0005615	0.907	extracellular space
GO:1903561	0.890	extracellular vesicle
GO:0005829	0.877	cytosol
GO:0070062	0.849	extracellular exosome
GO:0120025	0.635	plasma membrane bounded cell projection
GO:0043228	0.548	non-membrane-bounded organelle
GO:0043232	0.458	intracellular non-membrane-bounded organelle
GO:0032991	0.341	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.924	myosin ATPase.

[back to server]