StarFunc result for job id B0YJ81

User Input

>input (288 residues)
MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNGGASEAGEDRE
APGERRRLGVLATAWLTFYDIAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQT
FALLEIVHCLIGIVPTSVIVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVAWTVTEI
TRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPHVKKTGMFSIRLPN
KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0YJ81	1.000	1.000	4.918E-38	288	1.000	1.000	B0YJ81.pdb.gz	HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens OX=9606 GN=HACD1 PE=1 SV=1
2	AFDB:Q9QY80	0.757	0.776	5.424E-28	281	0.747	0.765	Q9QY80.pdb.gz	HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus OX=10090 GN=Hacd1 PE=2 SV=1
3	AFDB:Q6Y1H2	0.795	0.899	9.202E-24	254	0.528	0.598	Q6Y1H2.pdb.gz	HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1
4	AFDB:F4KGW0	0.659	0.814	6.916E-13	230	0.281	0.352	F4KGW0.pdb.gz	F4KGW0_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Arabidopsis thaliana OX=3702 GN=PAS2 PE=1 SV=1
5	AFDB:Q389R7	0.715	0.770	1.015E-11	266	0.236	0.256	Q389R7.pdb.gz	Q389R7_TRYB2 very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0290 PE=3 SV=1
6	AFDB:Q8K2C9	0.675	0.542	1.421E-10	362	0.177	0.141	Q8K2C9.pdb.gz	HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus OX=10090 GN=Hacd3 PE=1 SV=2
7	AFDB:H3BS72	0.672	0.489	2.086E-10	400	0.177	0.128	H3BS72.pdb.gz	H3BS72_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
8	AFDB:O14346	0.671	0.922	4.082E-10	208	0.201	0.279	O14346.pdb.gz	HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.15c PE=3 SV=2
9	AFDB:Q5VWC8	0.689	0.849	2.296E-9	232	0.167	0.207	Q5VWC8.pdb.gz	HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens OX=9606 GN=HACD4 PE=1 SV=1
10	AFDB:Q21905	0.560	0.773	7.266E-6	202	0.149	0.213	Q21905.pdb.gz	Q21905_CAEEL Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Caenorhabditis elegans OX=6239 GN=CELE_R10E4.9 PE=3 SV=1
11	PDB:1keyB	0.151	0.179	1.064	221	0.097	0.127	1keyB.pdb.gz
12	PDB:7xt8R	0.172	0.169	1.289	294	0.118	0.116	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
13	PDB:6o7ua	0.151	0.077	1.719	713	0.097	0.039	6o7ua.pdb.gz
14	PDB:7f73A	0.363	0.358	1.892	293	0.097	0.096	7f73A.pdb.gz
15	PDB:6wczA	0.202	0.171	2.405	350	0.080	0.066	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
16	PDB:7wvuR	0.162	0.159	3.057	298	0.128	0.124	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
17	PDB:4jrzA	0.144	0.215	3.208	155	0.083	0.155	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
18	PDB:5gtmB	0.176	0.105	3.208	522	0.111	0.061	5gtmB.pdb.gz
19	PDB:6bwjB	0.143	0.083	3.208	617	0.097	0.045	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
20	PDB:7o3vI	0.166	0.231	3.208	193	0.094	0.140	7o3vI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0YJ81	0.0	593	288	1.000	1.000	HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens OX=9606 GN=HACD1 PE=1 SV=1
2	Q9QY80	1.39e-173	482	281	0.806	0.826	HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus OX=10090 GN=Hacd1 PE=2 SV=1
3	Q6Y1H2	8.45e-107	312	254	0.497	0.563	HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1
4	F4KGW0	4.47e-42	146	230	0.295	0.370	F4KGW0_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Arabidopsis thaliana OX=3702 GN=PAS2 PE=1 SV=1
5	Q389R7	9.04e-29	112	266	0.247	0.267	Q389R7_TRYB2 very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0290 PE=3 SV=1
6	P40857	1.59e-25	102	217	0.243	0.323	HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHS1 PE=1 SV=1
7	O14346	3.21e-24	99.0	208	0.194	0.269	HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.15c PE=3 SV=2
8	Q8K2C9	1.14e-21	95.5	362	0.222	0.177	HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus OX=10090 GN=Hacd3 PE=1 SV=2
9	H3BPZ1	1.58e-21	94.7	337	0.219	0.187	H3BPZ1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
10	H3BS72	1.65e-21	95.5	400	0.219	0.158	H3BS72_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
11	H3BRL8	2.41e-21	92.4	245	0.205	0.241	H3BRL8_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
12	Q9P035	2.61e-21	94.4	362	0.219	0.174	HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2
13	Q5VWC8	3.68e-14	72.4	232	0.174	0.216	HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens OX=9606 GN=HACD4 PE=1 SV=1
14	Q21905	0.011	38.5	202	0.087	0.124	Q21905_CAEEL Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Caenorhabditis elegans OX=6239 GN=CELE_R10E4.9 PE=3 SV=1
15	E7ERH1	0.86	33.5	780	0.049	0.018	E7ERH1_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
16	P38687	2.1	32.3	599	0.097	0.047	SRP68_YEAST Signal recognition particle subunit SRP68 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP68 PE=1 SV=1
17	Q9Y6K1	2.2	32.3	912	0.066	0.021	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
18	Q04373	2.6	32.0	656	0.128	0.056	PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF6 PE=1 SV=1
19	M0R5U4	2.9	32.0	1373	0.083	0.017	M0R5U4_RAT Adenylate cyclase 9 OS=Rattus norvegicus OX=10116 GN=Adcy9 PE=1 SV=3
20	Q852L0	2.9	32.0	707	0.062	0.025	HD16N_ORYSJ Casein kinase 1-like protein HD16 OS=Oryza sativa subsp. japonica OX=39947 GN=HD16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14325 DUF4383	6.5e+02	12.0	Domain of unknown function (DUF4383)
2	PF04387 PTPLA	1.8e-53	192.0	Protein tyrosine phosphatase-like protein, PTPLA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355308

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215567	0.974	Very-long-chain enoyl-CoA reductase
2	9606.ENSP00000278353	0.974	Very-long-chain 3-oxoacyl-CoA reductase
3	9606.ENSP00000358831	0.909	Elongation of very long chain fatty acids protein 4
4	9606.ENSP00000378105	0.907	Elongation of very long chain fatty acids protein 6
5	9606.ENSP00000346693	0.879	Elongation of very long chain fatty acids protein 2
6	9606.ENSP00000322229	0.878	Fatty acid desaturase 1
7	9606.ENSP00000316329	0.874	Stearoyl-CoA desaturase 5
8	9606.ENSP00000359380	0.870	Acyl-CoA desaturase
9	9606.ENSP00000419503	0.836	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
10	9606.ENSP00000457380	0.836	Cementoblastoma-derived protein 1
11	9606.ENSP00000261875	0.835	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
12	9606.ENSP00000373153	0.804	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
13	9606.ENSP00000296955	0.746	Discoidin, CUB and LCCL domain containing 1
14	9606.ENSP00000359423	0.731	Myotubularin
15	9606.ENSP00000280362	0.725	6-pyruvoyl tetrahydrobiopterin synthase
16	9606.ENSP00000455547	0.707	Uncharacterized protein
17	9606.ENSP00000373684	0.634	Serine/threonine-protein kinase 38-like
18	9606.ENSP00000477602	0.581	Elongation of very long chain fatty acids protein 1
19	9606.ENSP00000226284	0.574	Bone sialoprotein 2
20	9606.ENSP00000464087	0.572	E3 ubiquitin-protein ligase RNF213

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0018812	1.000	3-hydroxyacyl-CoA dehydratase activity
GO:0080023	0.994	3R-hydroxyacyl-CoA dehydratase activity
GO:0046848	0.665	hydroxyapatite binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.996	organic substance biosynthetic process
GO:0044281	0.995	small molecule metabolic process
GO:0006629	0.995	lipid metabolic process
GO:0044249	0.995	cellular biosynthetic process
GO:0006633	0.988	fatty acid biosynthetic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0034030	0.979	ribonucleoside bisphosphate biosynthetic process
GO:1901135	0.978	carbohydrate derivative metabolic process
GO:0044272	0.978	sulfur compound biosynthetic process
GO:0034033	0.978	purine nucleoside bisphosphate biosynthetic process
GO:0006643	0.975	membrane lipid metabolic process
GO:1901568	0.944	fatty acid derivative metabolic process
GO:0035384	0.940	thioester biosynthetic process
GO:0030497	0.939	fatty acid elongation
GO:0006637	0.936	acyl-CoA metabolic process
GO:0009260	0.931	ribonucleotide biosynthetic process
GO:0042761	0.925	very long-chain fatty acid biosynthetic process
GO:0006164	0.921	purine nucleotide biosynthetic process
GO:0065007	0.916	biological regulation
GO:0043604	0.898	amide biosynthetic process
GO:1901570	0.895	fatty acid derivative biosynthetic process
GO:0050789	0.890	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0009152	0.875	purine ribonucleotide biosynthetic process
GO:0071616	0.873	acyl-CoA biosynthetic process
GO:0035337	0.869	fatty-acyl-CoA metabolic process
GO:0046467	0.705	membrane lipid biosynthetic process
GO:0030148	0.702	sphingolipid biosynthetic process
GO:0032502	0.699	developmental process
GO:0048856	0.399	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.

[back to server]