StarFunc result for job id B1AJZ9

User Input

>input (1412 residues)
MKAYLKSAEGFFVLNKSTTIGRHENSDLVLQSPDIDNHHALIEYNEAECSFVLQDFNSRN
GTFVNECHIQNVAVKLIPGDILRFGSAGLTYELVIENPPPVSFPWMRGPAPWPGPQPPRA
TQQPNQAPPPSHIPFHQGVQPAPMQRSWSQAFPRPTVVLPASHRRPVSANKEMFSFVVDD
ARKPPVIKQVWTNAMKLSEKSVAEGIPGAVPPAEIYVEEDLAQQDKDEIILLLGKEVSRL
SDYEIESKYKDVIIANLQNEVAELSQKVSETTTSRQNEKEISQKCQVLDEDIDAKQKEIQ
SLKSQISALQKGYSKVLCQTLSERNSEITSLKNEGENLKRDNAITSGMVSSLQKDILAKD
EQVQQLKEEVSHLKSQNKDKDHQLEALGSRCSVLKEELKQEDAHRELREAQEKELKLCKT
QIQDMEKEMKKLRAELRKSCTEQSVISRTLREKSKVEEKLQEDSRRKLLQLQEMGNRESV
IKINLERAVGQLEHFRSQVIKATYGRAKPFRDKPVTDQQLIEKITQVTEDNINFQQKKWT
LQKETQLSNSKQEETTENIEKLRTSLDSCQACMKISCCSHDLKKEVDLLQHLQVSPPVSG
LQKVVLDVLRHALSWLEEVEQLLRDLGILPSSPNKDQVQQFSGNSAVFTAGKAAGASGRE
GEAERGEARARGEAQSQNQATDGREGGKALEEYITQERNRAKETLEEERKRMQELESLLA
QQKKALAKSITQEKNRVKEALEEEQTRVQELEERLARQKEVLESSIAHEKRKAKEALESE
KRKVQDLENHLTQQKEISESNIAYEKRKAKEAMEKEKKKVQDLENRLTKQKEELELKEQK
EDVLNNKLSDALAMVEETQKTKATESLKAESLALKLNETLAELETTKTKMIMVEERLILQ
QKMVKALQDEQESQRHGFEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATL
KDNDPAPKEERPQDPLVAPMTESSAKDMAYEHLIDDLLAAQKEILSQQEVIMKLRKDLTE
AHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDRELKALEE
ALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQIEPVHTEAFSSSQEQQSFSDLGVRCKG
SRHEEVIQRQKKALSELRARIKELEKARSPDHKDHQNESFLDLKNLRMENNVQKILLDAK
PDLPTLSRIEILAPQNGLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIK
NMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRR
SKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQKVGTRKA
SLKMDQEREMLRKETSSKSSQSLLHSKPSGKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2ff4A	0.062	0.227	3.372E-9	379	0.021	0.079	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
2	PDB:7dvqX	0.062	0.499	3.803E-9	156	0.019	0.173	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
3	AFDB:O96685	0.064	0.071	9.539E-7	1261	0.025	0.029	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
4	PDB:2kb3A	0.061	0.561	5.108E-6	143	0.021	0.203	2kb3A.pdb.gz
5	PDB:5gm6U	0.062	0.432	7.322E-6	176	0.015	0.119	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
6	AFDB:B1AK66	0.063	0.214	5.012E-5	396	0.019	0.068	B1AK66.pdb.gz	B1AK66_HUMAN Smad nuclear interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=2 SV=1
7	PDB:5z56X	0.062	0.500	6.748E-5	159	0.013	0.119	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
8	AFDB:Q57Z65	0.079	0.093	2.116E-4	1188	0.127	0.152	Q57Z65.pdb.gz	Q57Z65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.380 PE=4 SV=1
9	AFDB:Q9UPV0	0.097	0.095	4.618E-4	1460	0.120	0.116	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:Q5DU05	0.089	0.088	1.534E-3	1446	0.135	0.131	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
11	AFDB:Q388V1	0.082	0.113	2.335E-3	959	0.128	0.189	Q388V1.pdb.gz	Q388V1_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0560 PE=4 SV=1
12	AFDB:Q921M4	0.079	0.107	4.256E-3	999	0.125	0.177	Q921M4.pdb.gz	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
13	AFDB:Q86YS3	0.070	0.141	5.411E-3	637	0.063	0.140	Q86YS3.pdb.gz	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
14	AFDB:A2AL36	0.078	0.049	5.746E-3	2334	0.138	0.084	A2AL36.pdb.gz	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
15	AFDB:F1P0K1	0.093	0.129	8.237E-3	997	0.125	0.177	F1P0K1.pdb.gz
16	PDB:4qd2B	0.040	0.217	1.272	143	0.009	0.091	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:7ungB0	0.046	0.208	1.350	193	0.021	0.155	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:3jb9E	0.024	0.194	1.617	98	0.013	0.194	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:6tuyA	0.033	0.052	1.936	667	0.018	0.037	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:3lx2A	0.030	0.086	2.461	247	0.006	0.032	3lx2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PV1	0.0	1143	704	0.445	0.892	Q96PV1_HUMAN KIAA1937 protein (Fragment) OS=Homo sapiens OX=9606 GN=KIAA1937 PE=2 SV=1
2	Q2M243	0.001	45.4	656	0.029	0.062	CCD27_HUMAN Coiled-coil domain-containing protein 27 OS=Homo sapiens OX=9606 GN=CCDC27 PE=1 SV=2
3	Q3URD3	0.005	43.9	845	0.013	0.021	SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus OX=10090 GN=Slmap PE=1 SV=2
4	Q14BN4	0.007	43.5	828	0.013	0.022	SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1
5	M9PCD4	0.12	39.3	1214	0.028	0.032	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
6	M9PCR7	0.15	38.9	1205	0.028	0.032	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
7	Q9VM93	0.15	38.9	1201	0.028	0.032	Q9VM93_DROME LD33094p OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=2
8	A0A1B0GWK2	0.18	38.9	863	0.039	0.064	A0A1B0GWK2_HUMAN Kazrin, periplakin interacting protein OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=1
9	Q8BIJ7	0.21	38.5	712	0.040	0.079	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
10	O35551	0.35	37.7	862	0.030	0.050	RABE1_MOUSE Rab GTPase-binding effector protein 1 OS=Mus musculus OX=10090 GN=Rabep1 PE=1 SV=2
11	O35550	0.37	37.7	862	0.030	0.050	RABE1_RAT Rab GTPase-binding effector protein 1 OS=Rattus norvegicus OX=10116 GN=Rabep1 PE=1 SV=1
12	P60469	0.73	37.0	1194	0.045	0.053	LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=Ppfia3 PE=1 SV=2
13	Q91Z79	0.76	37.0	1192	0.042	0.050	LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 GN=Ppfia3 PE=1 SV=2
14	O75145	0.83	36.6	1194	0.042	0.050	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
15	Q383R7	0.84	36.6	865	0.036	0.059	Q383R7_TRYB2 Trichohyalin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1880 PE=4 SV=1
16	Q6PHN1	0.85	36.6	1016	0.030	0.041	CCD57_MOUSE Coiled-coil domain-containing protein 57 OS=Mus musculus OX=10090 GN=Ccdc57 PE=1 SV=1
17	Q96CN9	0.97	36.2	775	0.038	0.070	GCC1_HUMAN GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1
18	Q20641	1.3	36.2	1963	0.047	0.034	Q20641_CAEEL Myosin-11 OS=Caenorhabditis elegans OX=6239 GN=nmy-1 PE=1 SV=2
19	Q9SHJ6	1.4	35.4	323	0.039	0.170	PMD2_ARATH Peroxisomal and mitochondrial division factor 2 OS=Arabidopsis thaliana OX=3702 GN=PMD2 PE=1 SV=1
20	Q8SX68	1.7	35.4	609	0.035	0.082	CT2NL_DROME CTTNBP2 N-terminal-like protein OS=Drosophila melanogaster OX=7227 GN=Naus PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	1.7e-13	62.0	FHA domain
2	PF16697 Yop-YscD_cpl	5.6e-05	34.7	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342518	0.720	Solute carrier family 35 member F4
2	9606.ENSP00000310829	0.712	Cilia- and flagella-associated protein 70
3	9606.ENSP00000251241	0.707	Probable ATP-dependent RNA helicase DHX40
4	9606.ENSP00000342676	0.697	Aurora kinase A-interacting protein
5	9606.ENSP00000273963	0.688	Kelch-like protein 8
6	9606.ENSP00000394899	0.662	Transmembrane protein 51
7	9606.ENSP00000310788	0.646	Olfactory receptor 5J2
8	9606.ENSP00000237163	0.642	Protein dopey-1
9	9606.ENSP00000348722	0.642	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
10	9606.ENSP00000441832	0.626	Probable G-protein coupled receptor 19
11	9606.ENSP00000313699	0.621	Hephaestin-like protein 1
12	9606.ENSP00000321805	0.609	GTP-binding protein Rit2
13	9606.ENSP00000260113	0.602	Peptidase inhibitor 15
14	9606.ENSP00000362792	0.596	Olfactory receptor 1N2
15	9606.ENSP00000448580	0.578	Transcription factor Spi-C
16	9606.ENSP00000272643	0.556	Thrombospondin type-1 domain-containing protein 7B
17	9606.ENSP00000386126	0.545	Uromodulin like 1
18	9606.ENSP00000262585	0.535	DENN domain-containing protein 3
19	9606.ENSP00000365253	0.534	Leucine-rich repeat-containing protein 38
20	9606.ENSP00000420387	0.525	Probable phospholipid-transporting ATPase IH

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.926	biological regulation
GO:0051179	0.919	localization
GO:0050789	0.889	regulation of biological process
GO:0071840	0.867	cellular component organization or biogenesis
GO:0016043	0.783	cellular component organization
GO:0050794	0.684	regulation of cellular process
GO:0051641	0.311	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.977	nucleus
GO:0005737	0.965	cytoplasm
GO:0043228	0.925	non-membrane-bounded organelle
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0016020	0.837	membrane
GO:0012505	0.535	endomembrane system
GO:0070013	0.325	intracellular organelle lumen
GO:0005829	0.320	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]