StarFunc result for job id B1AK53

User Input

>input (854 residues)
MALEQALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLHCLRFLVEEAA
LPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVV
NWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLAC
QEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDG
ATAMHFAASRGHTKVLSWLLLHGGEISADLWGGTPLHDAAENGELECCQILVVNGAELDV
RDRDGYTAADLSDFNGHSHCTRYLRTVENLSVEHRVLSRDPSAELEAKQPDSGMSSPNTT
VSVQPLNFDLSSPTSTLSNYDSCSSSHSSIKGQHPPCGLSSARAADIQSYMDMLNPELGL
PRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPVGPQAADIYMQTKNKLRHV
ETEALKKELSSCDGHDGLRRQDSSRKPRAFSKQPSTGDYYRQLGRCPGETLAARPGMAHS
EEVRARQPARAGCPRLGPAARGSLEGPSAPPQAALLPGNHVPNGCAADPKASRELPPPPP
PPPPPLPEAASSPPPAPPLPLESAGPGCGQRRSSSSTGSTKSFNMMSPTGDNSELLAEIK
AGKSLKPTPQSKGLTTVFSGIGQPAFQPDSPLPSVSPALSPVRSPTPPAAGFQPLLNGSL
VPVPPTTPAPGVQLDVEALIPTHDEQGRPIPEWKRQVMVRKMQLKMQEEEEQRRKEEEEE
ARLASMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPW
QRQVILKKGDIAKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AK53	1.000	1.000	1.037E-97	854	1.000	1.000	B1AK53.pdb.gz	ESPN_HUMAN Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1
2	AFDB:Q63618	0.600	0.611	3.085E-75	837	0.810	0.827	Q63618.pdb.gz	ESPN_RAT Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2
3	AFDB:Q9ET47	0.541	0.531	7.991E-74	871	0.811	0.796	Q9ET47.pdb.gz	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
4	AFDB:B0S4T8	0.430	0.254	4.696E-54	1476	0.555	0.321	B0S4T8.pdb.gz
5	PDB:8cs9A	0.330	0.352	6.341E-17	796	0.116	0.124	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	AFDB:A0A0R4IBH3	0.289	0.370	1.306E-16	650	0.173	0.228	A0A0R4IBH3.pdb.gz	A0A0R4IBH3_DANRE Ankyrin repeat domain 55 OS=Danio rerio OX=7955 GN=ankrd55 PE=4 SV=1
7	AFDB:A2A690	0.297	0.138	4.035E-13	1994	0.205	0.088	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
8	AFDB:P0C6S7	0.260	0.180	6.277E-13	1260	0.173	0.117	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
9	AFDB:Q0VGY8	0.361	0.175	1.147E-12	1856	0.171	0.079	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
10	PDB:5vkqA	0.240	0.153	3.132E-12	1499	0.111	0.063	5vkqA.pdb.gz
11	AFDB:Q93203	0.262	0.197	5.007E-11	1170	0.160	0.117	Q93203.pdb.gz	Q93203_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C11E4.6 PE=1 SV=2
12	AFDB:M9PCQ3	0.133	0.110	1.938E-9	1111	0.178	0.137	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
13	PDB:4oauC	0.297	0.358	2.277E-9	692	0.089	0.110	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.162	0.400	3.838E-9	229	0.082	0.306	2dvwA.pdb.gz
15	PDB:6aunA	0.239	0.315	9.290E-9	618	0.081	0.112	6aunA.pdb.gz
16	PDB:1wg0A	0.230	0.755	2.075E-8	243	0.069	0.243	1wg0A.pdb.gz
17	PDB:6v9hC	0.244	0.705	9.942E-8	270	0.064	0.204	6v9hC.pdb.gz
18	PDB:6pqpA	0.170	0.234	4.223E-7	615	0.055	0.076	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.176	0.603	1.022E-6	192	0.066	0.292	6jd6B.pdb.gz
20	PDB:6v9xA	0.182	0.269	4.519E-6	571	0.057	0.086	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S4T9	0.0	643	873	0.391	0.383	B0S4T9_DANRE Espin OS=Danio rerio OX=7955 GN=si:dkey-77h17.1 PE=4 SV=1
2	B1AK53	0.0	1726	854	1.000	1.000	ESPN_HUMAN Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1
3	Q63618	0.0	1126	837	0.792	0.808	ESPN_RAT Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2
4	Q9ET47	0.0	1132	871	0.813	0.797	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
5	Q6ZVH7	3.10e-113	371	1005	0.217	0.184	ESPNL_HUMAN Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL PE=1 SV=3
6	Q3UYR4	5.38e-108	357	1005	0.218	0.185	ESPNL_MOUSE Espin-like protein OS=Mus musculus OX=10090 GN=Espnl PE=1 SV=1
7	Q24341	1.51e-40	164	1408	0.094	0.057	Q24341_DROME Large Forked protein OS=Drosophila melanogaster OX=7227 GN=f PE=2 SV=2
8	M9MSB3	1.90e-40	164	1761	0.094	0.045	M9MSB3_DROME Forked, isoform J OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
9	Q9VX60	1.91e-40	164	1436	0.094	0.056	Q9VX60_DROME Forked, isoform B OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=2
10	M9MSB2	2.16e-40	164	1790	0.094	0.045	M9MSB2_DROME Forked, isoform H OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
11	Q17490	3.17e-36	151	6994	0.136	0.017	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
12	M9MSQ2	1.01e-35	149	1544	0.080	0.044	M9MSQ2_DROME Forked, isoform I OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
13	Q86B49	1.09e-35	149	1509	0.080	0.045	Q86B49_DROME Forked, isoform C OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
14	Q0KHR2	1.64e-35	148	1918	0.080	0.035	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
15	G5ECZ1	4.68e-35	147	1867	0.136	0.062	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
16	Q8MQG0	6.18e-35	146	1841	0.136	0.063	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
17	Q54KA7	3.40e-34	143	986	0.129	0.112	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
18	Q12955	8.45e-33	140	4377	0.124	0.024	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
19	A0A5F9ZHT8	3.84e-32	138	3891	0.116	0.025	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHF7	3.94e-32	138	3862	0.116	0.026	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5.9e-30	113.6	Ankyrin repeat
2	PF12796 Ank_2	1e-64	226.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.3e-27	102.4	Ankyrin repeat
4	PF13637 Ank_4	3.2e-47	169.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.6e-33	125.6	Ankyrin repeats (many copies)
6	PF02205 WH2	0.046	24.8	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367059

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265944	0.953	Myosin-IIIa
2	9606.ENSP00000371798	0.916	Fascin
3	9606.ENSP00000358994	0.898	Unconventional myosin-VI
4	9606.ENSP00000386213	0.889	Myosin-IIIb
5	9606.ENSP00000393392	0.878	Unconventional myosin-Ia
6	9606.ENSP00000354623	0.874	Whirlin
7	9606.ENSP00000336831	0.855	Plastin-1
8	9606.ENSP00000352834	0.852	Unconventional myosin-Ic
9	9606.ENSP00000386331	0.802	Unconventional myosin-VIIa
10	9606.ENSP00000334665	0.786	Fascin-2
11	9606.ENSP00000281172	0.778	Epidermal growth factor receptor kinase substrate 8
12	9606.ENSP00000299106	0.778	Junctional adhesion molecule C
13	9606.ENSP00000205890	0.758	Unconventional myosin-XV
14	9606.ENSP00000384312	0.753	TRIO and F-actin-binding protein
15	9606.ENSP00000304283	0.749	Ras-related C3 botulinum toxin substrate 3
16	9606.ENSP00000253754	0.730	PDZ and LIM domain protein 4
17	9606.ENSP00000397459	0.730	Dual specificity protein phosphatase 22
18	9606.ENSP00000372295	0.721	Gap junction beta-2 protein
19	9606.ENSP00000331983	0.720	F-actin-uncapping protein LRRC16A
20	9606.ENSP00000343690	0.720	Dihydropyrimidinase-related protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.915	cytoskeletal protein binding
GO:0003779	0.905	actin binding
GO:0044877	0.884	protein-containing complex binding
GO:0051015	0.427	actin filament binding
GO:0017124	0.309	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0016043	0.957	cellular component organization
GO:0030036	0.909	actin cytoskeleton organization
GO:0007015	0.773	actin filament organization
GO:0050789	0.616	regulation of biological process
GO:0050794	0.607	regulation of cellular process
GO:0051017	0.586	actin filament bundle assembly
GO:0048518	0.315	positive regulation of biological process
GO:0048522	0.310	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005622	0.997	intracellular anatomical structure
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0098858	0.992	actin-based cell projection
GO:0005737	0.991	cytoplasm
GO:0043229	0.989	intracellular organelle
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.954	cytosol
GO:0043227	0.945	membrane-bounded organelle
GO:0098862	0.944	cluster of actin-based cell projections
GO:0016020	0.916	membrane
GO:0005902	0.897	microvillus
GO:0015629	0.868	actin cytoskeleton
GO:0032420	0.865	stereocilium
GO:0032991	0.830	protein-containing complex
GO:0099512	0.662	supramolecular fiber
GO:0071944	0.480	cell periphery
GO:0043231	0.460	intracellular membrane-bounded organelle
GO:0005886	0.435	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]