StarFunc result for job id B1AK76

User Input

>input (121 residues)
MEQARDHLHLRWTTEQHMPEVEVQVKYRTAALSNQECQLYLRHSQQQQVLVVDFQAKLRQ
VFITETPRCGKKPYWNNEEAESKQNPGSIYCLLLLIRGGMSDSLIKREISNFEIVSKNKK
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2I1BSV9	0.190	0.016	1.638	2255	0.083	0.004	A0A2I1BSV9.pdb.gz	NVFA_ASPN1 Non-reducing polyketide synthase nvfA OS=Aspergillus novofumigatus (strain IBT 16806) OX=1392255 GN=nvfA PE=1 SV=1
2	AFDB:A9UL18	0.143	0.042	1.638	640	0.116	0.022	A9UL18.pdb.gz
3	AFDB:E9Q5N9	0.144	0.053	1.638	508	0.124	0.030	E9Q5N9.pdb.gz	E9Q5N9_MOUSE Zinc finger protein 395 OS=Mus musculus OX=10090 GN=Zfp395 PE=1 SV=1
4	AFDB:Q9H8N7	0.139	0.054	1.734	513	0.132	0.031	Q9H8N7.pdb.gz	ZN395_HUMAN Zinc finger protein 395 OS=Homo sapiens OX=9606 GN=ZNF395 PE=1 SV=2
5	PDB:1umzA	0.196	0.103	2.229	267	0.033	0.015	1umzA.pdb.gz	Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
6	AFDB:A0A0H3MHH0	0.131	0.067	2.309	288	0.099	0.042	A0A0H3MHH0.pdb.gz	A0A0H3MHH0_CHLT2 Uncharacterized protein OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=CTL0766 PE=1 SV=1
7	AFDB:E7ENI9	0.108	0.045	2.309	571	0.116	0.025	E7ENI9.pdb.gz	E7ENI9_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
8	AFDB:Q9ZVY7	0.240	0.137	2.590	241	0.041	0.021	Q9ZVY7.pdb.gz	OBP1A_ARATH Oil body-associated protein 1A OS=Arabidopsis thaliana OX=3702 GN=OBAP1A PE=1 SV=1
9	PDB:2ns2A	0.163	0.111	2.646	201	0.050	0.030	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
10	AFDB:O65933	0.252	0.023	2.742	1602	0.074	0.006	O65933.pdb.gz	O65933_MYCTU Probable polyketide synthase Pks8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks8 PE=4 SV=1
11	AFDB:B0QZE2	0.111	0.049	2.904	522	0.099	0.023	B0QZE2.pdb.gz	B0QZE2_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=1
12	AFDB:P39620	0.202	0.144	2.904	181	0.041	0.028	P39620.pdb.gz	GERQ_BACSU Spore coat protein GerQ OS=Bacillus subtilis (strain 168) OX=224308 GN=gerQ PE=1 SV=1
13	PDB:2x1gB	0.154	0.137	2.967	140	0.025	0.021	2x1gB.pdb.gz
14	PDB:1q4sA	0.207	0.178	3.142	142	0.041	0.035	1q4sA.pdb.gz	The Structure of 4-Hydroxybenzoyl-CoA Thioesterase from Arthrobacter sp. strain SU
15	PDB:6wxuB	0.186	0.106	3.142	273	0.066	0.029	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
16	PDB:1fujA	0.161	0.106	3.328	221	0.074	0.041	1fujA.pdb.gz	The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.
17	PDB:2pp1A	0.218	0.078	3.951	395	0.050	0.015	2pp1A.pdb.gz	Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
18	PDB:2ns2B	0.166	0.127	4.184	172	0.050	0.035	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
19	PDB:5t43A	0.222	0.182	4.184	158	0.083	0.063	5t43A.pdb.gz
20	PDB:7av6A	0.183	0.219	4.184	99	0.066	0.081	7av6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y675	1.88e-32	110	71	0.463	0.789	SNURF_HUMAN SNRPN upstream reading frame protein OS=Homo sapiens OX=9606 GN=SNURF PE=1 SV=1
2	Q9WU12	6.39e-31	107	71	0.446	0.761	SNURF_MOUSE SNRPN upstream reading frame protein OS=Mus musculus OX=10090 GN=Snurf PE=1 SV=1
3	Q9NVX7	1.9	30.0	518	0.132	0.031	KBTB4_HUMAN Kelch repeat and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KBTBD4 PE=1 SV=3
4	Q9LI77	2.7	29.6	537	0.182	0.041	GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GATA PE=2 SV=1
5	Q9Y6X3	4.4	28.9	613	0.140	0.028	SCC4_HUMAN MAU2 chromatid cohesion factor homolog OS=Homo sapiens OX=9606 GN=MAU2 PE=1 SV=2
6	Q9D2X5	4.5	28.9	619	0.140	0.027	SCC4_MOUSE MAU2 chromatid cohesion factor homolog OS=Mus musculus OX=10090 GN=Mau2 PE=1 SV=3
7	P62964	4.6	28.5	137	0.174	0.153	RABP1_BOVIN Cellular retinoic acid-binding protein 1 OS=Bos taurus OX=9913 GN=CRABP1 PE=1 SV=2
8	P62965	4.6	28.5	137	0.174	0.153	RABP1_MOUSE Cellular retinoic acid-binding protein 1 OS=Mus musculus OX=10090 GN=Crabp1 PE=1 SV=2
9	P62966	4.6	28.5	137	0.174	0.153	RABP1_RAT Cellular retinoic acid-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Crabp1 PE=1 SV=3
10	B0FLN8	5.4	28.1	137	0.182	0.161	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1
11	P40220	5.4	28.1	137	0.182	0.161	RABP1_CHICK Cellular retinoic acid-binding protein 1 OS=Gallus gallus OX=9031 GN=CRABP1 PE=2 SV=4
12	Q9BIW5	6.7	28.1	182	0.083	0.055	LIMC_DICDI LIM domain-containing protein C OS=Dictyostelium discoideum OX=44689 GN=limC PE=2 SV=1
13	Q9VGF9	9.7	28.1	411	0.140	0.041	Q9VGF9_DROME Aurora kinase OS=Drosophila melanogaster OX=7227 GN=aurA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07192 SNURF	3.8e-29	111.8	SNURF/RPN4 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000826

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000015742	0.547	Small nuclear ribonucleoprotein polypeptides B and B1
2	9593.ENSGGOP00000003913	0.535	Small nuclear ribonucleoprotein polypeptide N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.865	cellular process
GO:0050896	0.351	response to stimulus
GO:0065007	0.349	biological regulation
GO:0009607	0.344	response to biotic stimulus
GO:0009605	0.343	response to external stimulus
GO:0050789	0.333	regulation of biological process
GO:0050794	0.312	regulation of cellular process
GO:0071840	0.308	cellular component organization or biogenesis
GO:0071704	0.306	organic substance metabolic process
GO:0043207	0.303	response to external biotic stimulus
GO:0044419	0.302	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.982	cytoplasm
GO:0005654	0.977	nucleoplasm
GO:0005829	0.665	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]