StarFunc result for job id B1AKI9

User Input

>input (464 residues)
MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETS
FSLSKEAPREHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADING
QNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKY
DSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLWSVCSVTCGNGNQKR
TRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERW
MSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKDASGPKEKLEI
YKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5EGE1	0.510	0.513	5.900E-58	461	0.685	0.690	Q5EGE1.pdb.gz	ISM1_DANRE Isthmin-1 OS=Danio rerio OX=7955 GN=ism1 PE=2 SV=1
2	PDB:8ay1A	0.073	0.080	6.721E-3	421	0.034	0.038	8ay1A.pdb.gz
3	PDB:2n6fA	0.088	0.267	7.548E-3	136	0.037	0.125	2n6fA.pdb.gz
4	PDB:4a5wB	0.082	0.045	1.009E-2	871	0.037	0.020	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
5	PDB:3t5oA	0.079	0.043	1.515E-2	871	0.037	0.020	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
6	PDB:1w0rA	0.085	0.090	2.146E-2	442	0.041	0.043	1w0rA.pdb.gz
7	PDB:4e0sB	0.082	0.044	5.128E-2	898	0.037	0.019	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
8	AFDB:E9ADC3	0.088	0.070	1.888E-1	642	0.140	0.101	E9ADC3.pdb.gz	E9ADC3_LEIMA Choline kinase OS=Leishmania major OX=5664 GN=LMJF_27_1420 PE=4 SV=1
9	AFDB:Q7TSK7	0.096	0.054	2.835E-1	957	0.075	0.037	Q7TSK7.pdb.gz	ATL2_MOUSE ADAMTS-like protein 2 OS=Mus musculus OX=10090 GN=Adamtsl2 PE=1 SV=1
10	AFDB:O94804	0.064	0.037	3.004E-1	968	0.110	0.053	O94804.pdb.gz	STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1
11	AFDB:O54988	0.074	0.039	3.790E-1	1233	0.091	0.034	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
12	AFDB:Q9H2G2	0.057	0.029	3.790E-1	1235	0.082	0.031	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
13	PDB:7lbmr	0.066	0.036	5.542E-1	1034	0.034	0.015	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:5oqmd	0.105	0.109	6.225E-1	442	0.039	0.041	5oqmd.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
15	AFDB:Q57YV0	0.078	0.059	6.390E-1	635	0.091	0.066	Q57YV0.pdb.gz	Q57YV0_TRYB2 NOT2/NOT3/NOT5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.40 PE=4 SV=1
16	PDB:6w6eI	0.068	0.087	6.597E-1	357	0.024	0.031	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
17	PDB:4jdlC	0.047	0.135	7.409E-1	126	0.022	0.079	4jdlC.pdb.gz
18	AFDB:O35817	0.075	0.071	1.142	502	0.114	0.106	O35817.pdb.gz	AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1
19	AFDB:Q8GX37	0.071	0.046	1.441	782	0.082	0.049	Q8GX37.pdb.gz	FH9_ARATH Formin-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=FH9 PE=2 SV=2
20	AFDB:P35201	0.072	0.064	1.926	549	0.095	0.080	P35201.pdb.gz	CENPC_YEAST Inner kinetochore subunit MIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIF2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ATD1	0.0	850	454	0.920	0.941	ISM1_MOUSE Isthmin-1 OS=Mus musculus OX=10090 GN=Ism1 PE=1 SV=1
2	Q5EGE1	0.0	600	461	0.685	0.690	ISM1_DANRE Isthmin-1 OS=Danio rerio OX=7955 GN=ism1 PE=2 SV=1
3	Q6H9L7	2.09e-106	329	571	0.388	0.315	ISM2_HUMAN Isthmin-2 OS=Homo sapiens OX=9606 GN=ISM2 PE=1 SV=1
4	O60242	1.34e-04	47.0	1522	0.060	0.018	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
5	Q80ZF8	1.41e-04	47.0	1522	0.060	0.018	AGRB3_MOUSE Adhesion G protein-coupled receptor B3 OS=Mus musculus OX=10090 GN=Adgrb3 PE=1 SV=2
6	A0A0G2JV24	2.14e-04	46.2	1171	0.047	0.019	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
7	Q71SA3	2.16e-04	46.2	1170	0.047	0.019	Q71SA3_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=2 SV=1
8	P07996	2.61e-04	46.2	1170	0.052	0.021	TSP1_HUMAN Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2
9	P35441	4.22e-04	45.4	1170	0.050	0.020	TSP1_MOUSE Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1 PE=1 SV=1
10	F1SS26	5.32e-04	45.1	1170	0.050	0.020	F1SS26_PIG Thrombospondin 1 OS=Sus scrofa OX=9823 GN=THBS1 PE=1 SV=2
11	Q8CGM1	7.61e-04	44.7	1561	0.054	0.016	AGRB2_MOUSE Adhesion G protein-coupled receptor B2 OS=Mus musculus OX=10090 GN=Adgrb2 PE=1 SV=2
12	A2A3C1	0.002	43.1	1466	0.052	0.016	A2A3C1_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
13	A2A3C3	0.002	43.1	1499	0.054	0.017	A2A3C3_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
14	A2A3C6	0.002	43.1	1500	0.054	0.017	A2A3C6_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
15	C0HL12	0.002	43.1	1577	0.052	0.015	AGRB1_RAT Adhesion G protein-coupled receptor B1 OS=Rattus norvegicus OX=10116 GN=Adgrb1 PE=1 SV=1
16	A2A3C2	0.003	42.7	1554	0.054	0.016	A2A3C2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
17	O60241	0.003	42.7	1585	0.052	0.015	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
18	P11680	0.003	42.4	464	0.088	0.088	PROP_MOUSE Properdin OS=Mus musculus OX=10090 GN=Cfp PE=1 SV=2
19	Q96RW7	0.003	42.7	5635	0.050	0.004	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
20	B2RXR8	0.004	42.4	1206	0.086	0.033	B2RXR8_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03782 AMOP	4.5e-21	87.1	AMOP domain
2	PF19030 TSP1_ADAMTS	44	15.8	Thrombospondin type 1 domain
3	PF19035 TSP1_CCN	1.3e+02	14.4	CCN3 Nov like TSP1 domain
4	PF19028 TSP1_spondin	1.4	20.6	Spondin-like TSP1 domain
5	PF00090 TSP_1	0.0034	28.8	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.833	78 kDa glucose-regulated protein
2	9606.ENSP00000341988	0.762	Spermatogenesis-associated protein 31D1
3	9606.ENSP00000417498	0.723	Mucin-4
4	9606.ENSP00000378690	0.694	Calcium-binding protein 8
5	9606.ENSP00000429073	0.632	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
6	9606.ENSP00000284437	0.631	Uncharacterized protein C4orf19
7	9606.ENSP00000287380	0.630	TBC1 domain family member 31
8	9606.ENSP00000419266	0.600	Homeobox even-skipped homolog protein 1
9	9606.ENSP00000384545	0.594	BTB/POZ domain-containing protein 3
10	9606.ENSP00000351075	0.578	Sushi domain-containing protein 2
11	9606.ENSP00000367130	0.571	Transcription factor HES-3
12	9606.ENSP00000361097	0.544	Multimerin-2
13	9606.ENSP00000338624	0.540	Threonine aspartase 1
14	9606.ENSP00000339720	0.501	Cytochrome c oxidase subunit NDUFA4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048519	0.969	negative regulation of biological process
GO:0050794	0.860	regulation of cellular process
GO:0050793	0.829	regulation of developmental process
GO:0009987	0.821	cellular process
GO:0045765	0.796	regulation of angiogenesis
GO:0051241	0.767	negative regulation of multicellular organismal process
GO:0051093	0.642	negative regulation of developmental process
GO:0032501	0.396	multicellular organismal process
GO:0048518	0.376	positive regulation of biological process
GO:0050896	0.367	response to stimulus
GO:1901343	0.367	negative regulation of vasculature development
GO:0016525	0.362	negative regulation of angiogenesis
GO:0019222	0.341	regulation of metabolic process
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.979	cell periphery
GO:0005576	0.977	extracellular region
GO:0005622	0.943	intracellular anatomical structure
GO:0043226	0.914	organelle
GO:0016020	0.889	membrane
GO:0043227	0.862	membrane-bounded organelle
GO:0043231	0.707	intracellular membrane-bounded organelle
GO:0005737	0.635	cytoplasm
GO:0005615	0.553	extracellular space
GO:0005886	0.476	plasma membrane
GO:0012505	0.404	endomembrane system
GO:0031982	0.317	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]