StarFunc result for job id B2RNN3

User Input

>input (333 residues)
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGC
PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP
QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI
RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGK
FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDE
MWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RNN3	1.000	1.000	5.979E-48	333	1.000	1.000	B2RNN3.pdb.gz	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
2	AFDB:Q4ZJN1	0.462	0.462	7.634E-41	333	0.835	0.835	Q4ZJN1.pdb.gz	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
3	AFDB:Q4ZJM7	0.408	0.285	4.514E-18	482	0.435	0.301	Q4ZJM7.pdb.gz	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
4	AFDB:Q8BVD7	0.404	0.463	8.539E-18	289	0.354	0.408	Q8BVD7.pdb.gz	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
5	AFDB:Q8K479	0.401	0.546	1.094E-16	243	0.282	0.387	Q8K479.pdb.gz	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
6	AFDB:P27658	0.389	0.176	1.132E-15	744	0.435	0.195	P27658.pdb.gz	CO8A1_HUMAN Collagen alpha-1(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A1 PE=1 SV=2
7	PDB:5kc6B	0.343	0.753	3.778E-10	144	0.117	0.271	5kc6B.pdb.gz
8	AFDB:Q05A80	0.368	0.128	3.902E-10	1031	0.204	0.066	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
9	PDB:5h4bA	0.335	0.773	5.984E-9	136	0.117	0.287	5h4bA.pdb.gz
10	PDB:7e57B	0.233	0.590	1.499E-3	123	0.042	0.114	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
11	PDB:7l2zF	0.163	0.089	1.820E-2	664	0.033	0.017	7l2zF.pdb.gz
12	PDB:5a3oA	0.207	0.510	2.024E-2	114	0.051	0.149	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
13	PDB:5jovA	0.137	0.053	2.374E-2	949	0.033	0.012	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
14	PDB:5nxsA	0.144	0.157	2.936E-2	290	0.042	0.048	5nxsA.pdb.gz
15	PDB:6oj0A	0.214	0.348	4.736E-2	178	0.042	0.079	6oj0A.pdb.gz
16	AFDB:Q6P1D5	0.102	0.058	6.050E-2	963	0.150	0.052	Q6P1D5.pdb.gz	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
17	PDB:5eiyB	0.165	0.092	6.514E-2	658	0.039	0.020	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
18	PDB:7drtB	0.173	0.127	6.514E-2	496	0.051	0.034	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
19	AFDB:A0A1D8PPZ7	0.118	0.084	1.029E-1	520	0.150	0.096	A0A1D8PPZ7.pdb.gz	A0A1D8PPZ7_CANAL Mif2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIF2 PE=3 SV=1
20	AFDB:Q9BYH1	0.131	0.059	2.978E-1	1024	0.153	0.050	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RNN3	0.0	664	333	1.000	1.000	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
2	D3ZJ76	0.0	526	331	0.829	0.834	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
3	P0C862	0.0	647	333	0.976	0.976	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
4	Q4ZJN1	0.0	536	333	0.835	0.835	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
5	P83371	3.36e-66	218	508	0.459	0.301	OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta OX=8018 GN=otol1 PE=1 SV=1
6	A5PN28	3.67e-65	215	489	0.429	0.292	OTO1A_DANRE Otolin-1-A OS=Danio rerio OX=7955 GN=otol1a PE=1 SV=1
7	Q4ZJM7	1.15e-63	211	482	0.429	0.297	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
8	A8K660	2.80e-52	174	244	0.291	0.398	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
9	Q15848	2.80e-52	174	244	0.291	0.398	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q60994	3.83e-52	174	247	0.363	0.490	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
11	Q3Y5Z3	9.75e-52	173	240	0.291	0.404	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
12	Q8K3R4	8.27e-50	168	244	0.297	0.406	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
13	Q9D8U4	4.37e-44	155	294	0.306	0.347	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
14	Q9BXJ5	6.16e-43	151	285	0.306	0.358	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
15	Q8BVD7	8.79e-39	140	289	0.318	0.367	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
16	A2RQR3	1.11e-38	147	655	0.399	0.203	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
17	Q9BXJ0	3.94e-35	130	243	0.273	0.374	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
18	A0A0G2K845	4.61e-34	126	218	0.237	0.362	A0A0G2K845_RAT Adiponectin, C1Q and collagen domain containing OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
19	Q8K479	7.26e-34	126	243	0.267	0.366	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
20	Q4VAQ0	1.15e-33	130	427	0.381	0.297	Q4VAQ0_HUMAN COL8A2 protein OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	0.0017	29.7	BclA C-terminal domain
2	PF00386 C1q	1.5e-33	127.2	C1q domain
3	PF01391 Collagen	2.3e-25	99.4	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371607	0.695	Mitochondrial intermediate peptidase
2	9606.ENSP00000371503	0.684	Complement C1q and tumor necrosis factor-related protein 9A
3	9606.ENSP00000334128	0.517	Cytochrome P450 27C1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.983	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.959	cellular process
GO:0065007	0.950	biological regulation
GO:0008152	0.907	metabolic process
GO:0050789	0.900	regulation of biological process
GO:0071704	0.886	organic substance metabolic process
GO:0044238	0.854	primary metabolic process
GO:0050794	0.833	regulation of cellular process
GO:0044237	0.806	cellular metabolic process
GO:0019222	0.804	regulation of metabolic process
GO:0031323	0.740	regulation of cellular metabolic process
GO:0051174	0.714	regulation of phosphorus metabolic process
GO:0032787	0.708	monocarboxylic acid metabolic process
GO:0019220	0.702	regulation of phosphate metabolic process
GO:0080090	0.663	regulation of primary metabolic process
GO:0060255	0.567	regulation of macromolecule metabolic process
GO:0051171	0.556	regulation of nitrogen compound metabolic process
GO:0001932	0.477	regulation of protein phosphorylation
GO:0048518	0.402	positive regulation of biological process
GO:0044255	0.384	cellular lipid metabolic process
GO:0010562	0.383	positive regulation of phosphorus metabolic process
GO:0051338	0.382	regulation of transferase activity
GO:0045937	0.350	positive regulation of phosphate metabolic process
GO:0032501	0.302	multicellular organismal process
GO:0030258	0.302	lipid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.995	extracellular region
GO:0005615	0.948	extracellular space
GO:0005622	0.794	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]