StarFunc result for job id B2RPK0

User Input

>input (211 residues)
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHSDASVNFSEFSNKCSERWKTMSAKEKGKF
EDMAKADKTHYERQMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYHPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPGEKKAAKLKEKYEKDIAAYQAKGKPEAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEDEEDEEDDDDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09429	0.755	0.742	1.815E-26	215	0.943	0.926	P09429.pdb.gz	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
2	AFDB:F2Z594	0.419	0.404	4.281E-25	220	0.829	0.795	F2Z594.pdb.gz	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
3	AFDB:F1RJ01	0.426	0.428	6.081E-22	210	0.678	0.681	F1RJ01.pdb.gz	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
4	AFDB:Q6NX86	0.710	0.730	2.079E-21	205	0.711	0.732	Q6NX86.pdb.gz	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
5	AFDB:P40618	0.422	0.439	2.204E-21	202	0.649	0.678	P40618.pdb.gz	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3
6	AFDB:P07746	0.471	0.484	1.276E-20	204	0.621	0.642	P07746.pdb.gz	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
7	AFDB:X2JGB1	0.405	0.403	1.551E-18	212	0.649	0.646	X2JGB1.pdb.gz	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1
8	AFDB:P23497	0.400	0.102	1.180E-16	879	0.687	0.165	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
9	AFDB:Q24537	0.384	0.215	3.318E-15	393	0.441	0.237	Q24537.pdb.gz	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
10	AFDB:Q8WW32	0.395	0.445	3.586E-13	186	0.322	0.366	Q8WW32.pdb.gz	HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens OX=9606 GN=HMGB4 PE=1 SV=2
11	PDB:1j5nA	0.352	0.737	2.470E-4	93	0.185	0.419	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.220	0.105	6.678E-1	451	0.081	0.038	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:6zm7CE	0.169	0.287	1.704	124	0.085	0.145	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:7pj1B	0.130	0.186	2.153	122	0.095	0.164	7pj1B.pdb.gz
15	PDB:5mkkA	0.121	0.055	2.886	593	0.085	0.030	5mkkA.pdb.gz
16	PDB:7shfC	0.144	0.088	3.439	400	0.104	0.055	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
17	PDB:7k26D	0.157	0.185	3.867	176	0.100	0.119	7k26D.pdb.gz	Anisotropic Dynamics and Mechanics of Macromolecular Crystals Containing Lattice-Patterned Polymer Networks.
18	PDB:2rvqD	0.136	0.190	4.609	129	0.076	0.124	2rvqD.pdb.gz
19	PDB:7n9sA	0.128	0.014	5.494	2365	0.085	0.008	7n9sA.pdb.gz
20	PDB:1kw2A	0.139	0.065	5.825	455	0.057	0.026	1kw2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2Z594	5.53e-114	326	220	0.801	0.768	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
2	P09429	3.68e-112	321	215	0.791	0.777	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
3	P10103	3.68e-112	321	215	0.791	0.777	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
4	P63158	3.68e-112	321	215	0.791	0.777	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
5	P63159	3.68e-112	321	215	0.791	0.777	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
6	P12682	3.09e-111	318	215	0.787	0.772	HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
7	Q9YH06	2.42e-105	304	215	0.749	0.735	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
8	F1NPU8	3.86e-96	280	207	0.682	0.696	F1NPU8_CHICK High mobility group box 2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=1 SV=1
9	P26584	9.16e-96	279	207	0.682	0.696	HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2
10	Q5U071	3.40e-94	275	208	0.701	0.712	Q5U071_HUMAN High-mobility group box 2 OS=Homo sapiens OX=9606 PE=2 SV=1
11	P26583	3.52e-94	275	209	0.701	0.708	HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2
12	P40673	3.52e-94	275	209	0.701	0.708	HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3
13	P52925	3.43e-93	273	210	0.692	0.695	HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2
14	P07746	3.60e-93	273	204	0.621	0.642	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
15	P30681	8.32e-93	272	210	0.697	0.700	HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3
16	Q3U566	8.32e-93	272	210	0.697	0.700	Q3U566_MOUSE HMG box domain-containing protein OS=Mus musculus OX=10090 GN=Hmgb2 PE=2 SV=1
17	Q6NX86	6.49e-90	264	205	0.649	0.668	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
18	F1RJ01	2.68e-87	258	210	0.635	0.638	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
19	P17741	2.99e-87	258	210	0.635	0.638	HMGB2_PIG High mobility group protein B2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=1 SV=2
20	X2JGB1	8.17e-80	239	212	0.578	0.575	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	2.4e-33	125.7	HMG (high mobility group) box
2	PF09011 HMG_box_2	6.1e-34	127.8	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 13616.ENSMODP00000010935

Rank	PPI partner	STRING score	Description
1	13616.ENSMODP00000018610	0.850	Advanced glycosylation end product-specific receptor
2	13616.ENSMODP00000024473	0.840	Belongs to the Toll-like receptor family.
3	13616.ENSMODP00000036364	0.819	Belongs to the Toll-like receptor family.
4	13616.ENSMODP00000009014	0.810	Cellular tumor antigen p53
5	13616.ENSMODP00000004305	0.694	High mobility group box 2
6	13616.ENSMODP00000020486	0.685	CREB binding protein
7	13616.ENSMODP00000005484	0.672	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
8	13616.ENSMODP00000007805	0.665	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
9	13616.ENSMODP00000004058	0.649	Jun proto-oncogene, AP-1 transcription factor subunit
10	13616.ENSMODP00000034332	0.649	Interferon regulatory factor 5
11	13616.ENSMODP00000027315	0.638	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
12	13616.ENSMODP00000018835	0.624	Uncharacterized protein
13	13616.ENSMODP00000004375	0.623	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
14	13616.ENSMODP00000020160	0.615	Lysine (K)-specific demethylase 1A
15	13616.ENSMODP00000010131	0.614	H1 histone family, member X
16	13616.ENSMODP00000004230	0.608	Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
17	13616.ENSMODP00000025687	0.607	Belongs to the Toll-like receptor family.
18	13616.ENSMODP00000014557	0.606	Interleukin-1 receptor-associated kinase 1
19	13616.ENSMODP00000037231	0.606	Interferon beta 1
20	13616.ENSMODP00000005670	0.602	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	0.999	DNA binding
GO:0005515	0.991	protein binding
GO:0008301	0.957	DNA binding, bending
GO:0003690	0.931	double-stranded DNA binding
GO:0043565	0.783	sequence-specific DNA binding
GO:0000976	0.768	transcription cis-regulatory region binding
GO:0140110	0.495	transcription regulator activity
GO:0140297	0.384	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.947	regulation of biological process
GO:0050794	0.890	regulation of cellular process
GO:0050896	0.885	response to stimulus
GO:0071840	0.762	cellular component organization or biogenesis
GO:0016043	0.733	cellular component organization
GO:0048518	0.676	positive regulation of biological process
GO:0006950	0.641	response to stress
GO:0019222	0.635	regulation of metabolic process
GO:0032501	0.598	multicellular organismal process
GO:0060255	0.590	regulation of macromolecule metabolic process
GO:0032502	0.577	developmental process
GO:0042221	0.546	response to chemical
GO:0010033	0.535	response to organic substance
GO:0048522	0.481	positive regulation of cellular process
GO:0009893	0.477	positive regulation of metabolic process
GO:0048856	0.454	anatomical structure development
GO:0010604	0.438	positive regulation of macromolecule metabolic process
GO:0051716	0.428	cellular response to stimulus
GO:0080090	0.419	regulation of primary metabolic process
GO:0051171	0.419	regulation of nitrogen compound metabolic process
GO:0031323	0.419	regulation of cellular metabolic process
GO:0010468	0.414	regulation of gene expression
GO:1901700	0.380	response to oxygen-containing compound
GO:0070887	0.366	cellular response to chemical stimulus
GO:0007275	0.360	multicellular organism development
GO:0071704	0.345	organic substance metabolic process
GO:0009889	0.345	regulation of biosynthetic process
GO:0010556	0.311	regulation of macromolecule biosynthetic process
GO:0031326	0.310	regulation of cellular biosynthetic process
GO:0009605	0.308	response to external stimulus
GO:0051252	0.307	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043227	0.959	membrane-bounded organelle
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0005634	0.950	nucleus
GO:0005737	0.858	cytoplasm
GO:0000785	0.779	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]